Description
Gene Model Namearadu.Aradu.00NXK
Micro Synteny Viewaradu.Aradu.00NXK
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_1KSG41
Descriptionsalicylic acid carboxyl methyltransferase; IPR005299 (SAM dependent carboxyl methyltransferase); GO:0008168 (methyltransferase activity)
Protein domainsG3DSA:3.40.50.150 PF03492 PTHR31009 PTHR31009:SF0 SSF53335
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.00NXK.1

Sequences
Gene Model Namearadu.Aradu.00NXK
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.00NXK.1 sequence

>aradu.Aradu.00NXK.1
GATCAATATTCAATTCACCATCGACTTGCCAGCTGATGATTGCTTAATTA
CATTAGTGCATGCTTGTTAGGTACAAGCCTACAAATTAAGTTGTTCTCTC
GTCTTTTCCATATGATCAACGATGGCAACTGAGCAAGTCCTTCACATGAA
TGGAGGTACCGGAGAAACAAGCTACGCTAACAACTCTACGTTTCAAAAAA
ATGCTATACTCCGTACAAAACATATCATGGAAGAGTGCATAATCAAATTG
TATCGGTCAACTTCACCAGAATGTTTGAAAGTGGCGGATTTAGGGTGCTC
ATCGGGTCCAAATACACTTATGGTAGCATCTACTACTGTCAAAGTAGTTG
ATGCCATGAGTCAAACCTTGAATCAAGACCCACCCATGTACCAATTTTTC
CTGAATGATCTATATGGCAATGATTTCAATAACATATTTAAGTCAGTCCC
TGATTTTTACAAGAGGATGGAAGAGGAAATTGGTCACAAATTTGGACCAT
GTTTCATTAGTGGCACCCCTGGCACATTTTATGGGAGACTCTTCCCCAAC
CATTCCATTCACTTCTTTCATTCTTCCAGCACCTTGCACTGGCTTTCTCA
GATTCCGAAGGAGTTGAATAGTGAAGTAGAAAAGCCAATGAACAAAGGAG
CAATATGTCTCACAAAGGCAAGCCCTCCAGGAGTTCACAAAGCTTATAGT
GAGCAATTTCAAAGAGACTTGAAGGTGTTCTTGCGATCACGTTCAGAAGA
ATTGATTCCTGGTGGTGCTATGGTCCTTTCTATGATCATTTTAGACCAAA
ATCATAATACAATCAATGGTTGGGAGGTAATTGGTGCAATACTCAACAAC
ATGGTCTCATAGCACAAGGTTGAGAAGAGAAAGTTAGACTCATACAACAT
ATCATCATACTTTCCTACGGCTGAAGAGGTTAGGCAAGTAATTGAAGAAG
AAGGATCGTTTAACATTCAAAGGATGGAGAAAATAATATATGATATAGTG
GAGTGTAATGGAGACTAGTAATGACGACTCTTTTATTCATGAGGATGAAG
ACGCAATTGGAGAGAGGCAAGCCAGGACCATAAGAGCCGTAAGTGAACCT
ATTTTGAAGGCAGAATTTGGGGAGGAAATTATGGATGAATTGTTCACAAG
GTTCAAAAGCAAAACCATCCAACTCAACAGAGTAAAGAAATTGAAGGGTG
CTACTCTAGTCGCCTACATGACAAAAGATACTTGACAATGAGACATGAGA
AATAATATATCTTACGGTTGGTTGAACTGTACCCTTTTGTCTTTTATTAT
CCTAATAGAGTTTCCTTTGTAATAACTTGCCGTATGTGCCAAATATTGTT
GAGTTTTGGTGGTAAGTCCCTATACCTATCCTCAATGACTCAATGGGTTT
AAGCCTGTATAGTCATTTACGAAGAGAGACTTTT
back to top
Protein Sequence

aradu.Aradu.00NXK.1 sequence

>aradu.Aradu.00NXK.1
MATEQVLHMNGGTGETSYANNSTFQKNAILRTKHIMEECIIKLYRSTSPE
CLKVADLGCSSGPNTLMVASTTVKVVDAMSQTLNQDPPMYQFFLNDLYGN
DFNNIFKSVPDFYKRMEEEIGHKFGPCFISGTPGTFYGRLFPNHSIHFFH
SSSTLHWLSQIPKELNSEVEKPMNKGAICLTKASPPGVHKAYSEQFQRDL
KVFLRSRSEELIPGGAMVLSMIILDQNHNTINGWEVIGAILNNMVS.
back to top
Expression

Gene expression for aradu.Aradu.00NXK has been determined by its associated transcript, Adur2146_comp1_c0_seq2 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.