Description
Gene Model Namearadu.Aradu.06HW9
Micro Synteny Viewaradu.Aradu.06HW9
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_0V9YT0
DescriptionAuxin efflux carrier family protein; IPR004776 (Auxin efflux carrier); GO:0016021 (integral component of membrane), GO:0055085 (transmembrane transport)
Protein domainsPF03547 PTHR31752 PTHR31752:SF0
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.06HW9.1

Sequences
Gene Model Namearadu.Aradu.06HW9
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.06HW9.1 sequence

>aradu.Aradu.06HW9.1
ATGATCACGGGTAAGGATATTTACGATGTGTTTGCAGCTATTGTGCCACT
CTATGTGGCTATGATCTTAGCATATGGTTCTGTTCGGTGGTGGAAGATCT
TCACGCCGGACCAATGCTCCGGGATTAACCGCTTCGTTGCGGTCTTTGCA
GTTCCACTCCTCTCTTTCCACTTCATCTCCTCCAATGACCCTTACGCCAT
GAACTACCACTTCATAGCAGCCGATTCTCTTCAGAAGCTTGTCATCTTGG
CTGCGCTTTTTCTATGGAACACCTTCACAAAACACGGTACCTTGGATTGG
ACCATCACCCTCTTCTCACTCTCCACTCTCCCAAACACACTCGTCATGGG
AATCCCTCTCCTCAAGGCCATGTACGGCGACTTCTCCGGCACCCTCATGG
TCCAAATCGTTGTCTTGCAGAGCGTTATATGGTACACTCTCATGCTCTTC
ATGTTCGAATACAGGGGTGCTAAGCTTCTTATCTCCGAGCAGTTCCCGGA
GACTGCAGGCTCCATCACCTCCTTCAGGGTTGACTCCGATGTGGTGTCCC
TCAACGGCAGGGATCCACTGCAAGCGGATGCAGAGATTGGTGAAGATGGA
AAGCTTCATGTTGTGGTGAAGAGATCAGGTGCTTCCTCCATGATATCTTC
CTTCAACAAGTCTCATTTAACTTCCATGACTCCTCGAGCTTCCAATCTCA
CCGGTGTTGAGATCTATTCCGTTCAATCATCCAGGGAACCAACACCCAGA
GCTTCCAGTTTCAATCAAACGGACTTCTTCGCCATGTTTAATGCAAGCAA
AGCACCCAGTCCCAAACACGGTTACACCAATGGCGAGTACTCCAAAGGAG
CGACTCCGAGGACATCGAATTTTGAAGAGGAGATGACGATGAAGATGCAT
AATAAGAAAAGAGGAGCGAGAAGCATGAGTGGCGAACTGTTCAACTCTTC
TTATCCGCCTCCGAACCCTATGTTTTCAGGATCTACAAGCGGCTTAAAGA
AGAAAGATGGCGGCGGCAGCGGAACTACTCCTCCTAACAACAAGGAGTTG
CACATGTTTGTATGGAGTTCAAGCGCTTCCCCAGTCTCTGAGGGGAATCT
CAGACAAGCTGTTCATAGTGCTGCATCTACTGATTTTGATAAGGCGGTTA
CACCAGAGACTCTTGCCTCCAAAGGTAATAATTAA
back to top
Protein Sequence

aradu.Aradu.06HW9.1 sequence

>aradu.Aradu.06HW9.1
MITGKDIYDVFAAIVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAVFA
VPLLSFHFISSNDPYAMNYHFIAADSLQKLVILAALFLWNTFTKHGTLDW
TITLFSLSTLPNTLVMGIPLLKAMYGDFSGTLMVQIVVLQSVIWYTLMLF
MFEYRGAKLLISEQFPETAGSITSFRVDSDVVSLNGRDPLQADAEIGEDG
KLHVVVKRSGASSMISSFNKSHLTSMTPRASNLTGVEIYSVQSSREPTPR
ASSFNQTDFFAMFNASKAPSPKHGYTNGEYSKGATPRTSNFEEEMTMKMH
NKKRGARSMSGELFNSSYPPPNPMFSGSTSGLKKKDGGGSGTTPPNNKEL
HMFVWSSSASPVSEGNLRQAVHSAASTDFDKAVTPETLASKGNN.
back to top