Description
Gene Model Namearadu.Aradu.0KF8R
Micro Synteny Viewaradu.Aradu.0KF8R
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_6PY7X8
DescriptionProtein of unknown function (DUF677); IPR007749 (Protein of unknown function DUF677)
Protein domainsCoil PF05055 PTHR31113 PTHR31113:SF0
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.0KF8R.1

Sequences
Gene Model Namearadu.Aradu.0KF8R
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.0KF8R.1 sequence

>aradu.Aradu.0KF8R.1
GGATTTTCTTTTCCCTCTTAACCTCTCTCCCCACCTCACAAGATATCTCC
CTCTATATATATTCTTTATTTTAGTCTCATGCTTCCTTCATTCACTTAAT
TAGATAGACAAGATTTCATTCTTCAGCTTCAGATGCGCTTGCCATGATGA
CACACACTTGGTCCCTTTGTTGTCCTACTCCAACGTTAACAAGAACAACG
CCCGGTAGATCAGAGAAAGAATGTGATGGGCAAGACAGCTTGTGTGTGAA
GGCAAACGTGAATGAAGAATACTTAGAAGCATTTAGAACTAAGTCATACA
TAGAAATATGCAACAAAGCACAAGGCCAACTTGGGAGAACAATAAGAAGA
TCGCCACTATTGTCTTCAAATAACAATTCTCCATCAACAAATTCATCTTC
TTCTACCCTTCCATTCTGCAAGCACCTCACAGAGTTCTTGCTTGATCCAA
GGCAAGAGAACATAACAAGCGTGGCTGAAACCACCAAAGTTCACCATCTC
CTTGTGAACTACTTTGAATCCAGCTTAGAAGCCTGCCATTGTTGCGACCA
AATCCTCCAAGGGCTCCACTCCATGAGACTCTCTTATAGAAGAATCAAGA
GGGTTGTTAAGATAAGCAAAATGGTTCTTGATGAAGACTGTAACAACAAT
GGAGACCAACAACAACAAATCCAAAAGGATGTTATCTATAGAGAGCTTGC
TTCTTTTGCATTGCAGAACAACCCTTTGTCCATTCAATTCCACGACATTC
ATCAAAGGTTCATGGAGCTGTTGCATAGGCTGAGATCAAAGAGAGTGAAG
ATTCAGAGGAAACTAACATGGAAGAGCATATGCAAGAAGGTGGCAGGGAT
TGGTCTTGTGACAGCACACAGTGCTATAGTTGTTGCATTATTGGTGCTTT
GTTTTCACAGCATTGTGGGGTTGGTGGCTGCACCGGGAATTCTAGGGGGC
TTGGTTGGTTGGTTGATAAAGAGAATATTCAAAGGGAAGAATAGTAAGAA
TGGAAGAATTAGGAGAAGTTACTGTGAGAGGCTGTGTGAGCAACTAGATG
TGGCAGCAAAAGGGATATATATAGTGATAAATGAGTTGAACACAGTGAGT
AGGATGGTGATGAGGCTGCGTGATGAGGTGGAGCATAGAAGGGTCATTGC
ACAAGTGTGTGTCAGGAACTATGGAAAGTCTGAGATACTGAGGCAGGTTC
TTAGGGACTTGAATGACAATCAGTCAAGCTTTTTGGATCAGTTGGAGGAG
CTTGAGAACCATATTTACTTTTGCTTTCTCACCATTAACAGATCAAGGAG
CCTCCTTCTCCAAGAAATTACCCAGGATTTATAAGCATTCATTCAAATGT
TAAGTATTGGTTCCTCTATTATAATTTTTTGGAGGCCCTATATATGTGTG
ATTAAAAGGGAGTCTTTGGTTGAGTTGTTTGTATGTAAGGTCCTAAGCTA
AACTGCCTAGTATATGTTCTGTCTTTTCACAATGTATAGTTCCTCTTCCT
TCTCATAGATCCAGCTGGAAGTGATATGAGCGAATTCCTGTAAAAGTTCA
AGTTTCCATCTGCTGATGCGTGAATTTTTGTTGTATACATGAATTCGTGG
GCTCTGATTACTAGCTGGCTTAGAATACCACAGTATTACATTGATCTCAT
TATTACAATTGCTATTATCGTTTGAAGAATAGGTGTCTTCAAATGAACTC
GCCTGATAGAACAGAATCATATAATAAGCAAGGTTCTTTATCAAATATGT
TGTGTGATTCATAATTTTGAACATTTTACTAATGTACATTAACTTTTAAA
CTTGTACAGTTTAATCAACATTTAATTAACCTTGATTGGCCGCTCAA
back to top
Protein Sequence

aradu.Aradu.0KF8R.1 sequence

>aradu.Aradu.0KF8R.1
ASDALAMMTHTWSLCCPTPTLTRTTPGRSEKECDGQDSLCVKANVNEEYL
EAFRTKSYIEICNKAQGQLGRTIRRSPLLSSNNNSPSTNSSSSTLPFCKH
LTEFLLDPRQENITSVAETTKVHHLLVNYFESSLEACHCCDQILQGLHSM
RLSYRRIKRVVKISKMVLDEDCNNNGDQQQQIQKDVIYRELASFALQNNP
LSIQFHDIHQRFMELLHRLRSKRVKIQRKLTWKSICKKVAGIGLVTAHSA
IVVALLVLCFHSIVGLVAAPGILGGLVGWLIKRIFKGKNSKNGRIRRSYC
ERLCEQLDVAAKGIYIVINELNTVSRMVMRLRDEVEHRRVIAQVCVRNYG
KSEILRQVLRDLNDNQSSFLDQLEELENHIYFCFLTINRSRSLLLQEITQ
DL.
back to top
Expression

Gene expression for aradu.Aradu.0KF8R has been determined by its associated transcript, Adur18420_comp1_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.