Description
Gene Model Namearadu.Aradu.11KMG
Micro Synteny Viewaradu.Aradu.11KMG
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_3RLVNT
Descriptiongeneral regulatory factor 9; IPR000308 (14-3-3 protein), IPR023410 (14-3-3 domain); GO:0019904 (protein domain specific binding)
Protein domainsCoil G3DSA:1.20.190.20 PF00244 PIRSF000868 PR00305 PTHR18860 SM00101 SSF48445
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.11KMG.1

Sequences
Gene Model Namearadu.Aradu.11KMG
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.11KMG.1 sequence

>aradu.Aradu.11KMG.1
AAGTCTCACTACACTGTGAGCAGAGTGAGATAGTGGAACCAGAGAGAACA
ACAGGTTCAGGCTCAGATCAACAACAACAATGGCTTCCTCTTCCAAGGAC
CGTGAGAACTTCGTCTATATAGCTAAGCTAGCCGAGCAAGCTGAACGCTA
TGATGAAATGGTGGAGGCCATGAAGAAGGTAGCGAAGCTTGACGTTGAGC
TGAGTGTGGAAGAGAGGAACCTGTTCTCTGTTGGGTACAAGAACGTGGTG
GGTTCAAGGAGGGCTTCATGGAGGATCCTGTCAAAGATAGAGCAGAAGGA
AGAGTCAAGGGGCAATGAGGTAAATGCAAAGCGCATAAGGGAATACATGC
ACAAGGTGGAGTTGGAGCTCTCCAAAATTTGCAGTGACATTATGATTGTC
TTAGATGAGCATCTTATCCCATCCACTAATGTTGCTGAGTCCACTGTTTT
TTACTATAAAATGAAAGGAGACTACTATCGGTATTTAGCGGAATTTAAAG
ATGGTGATGAGAAAAAAGAGGTGGCAGATCAGTCACTTAAAGCATATGAG
GCAGCTGCTACAACTGCCGAGAGTGAATTACCACCTACGCATCCTATCCG
ACTGGGTCTAATTCTAAATTTCTCAGTGTTTTATTATGAGATAATGAATT
CACCTGAAAGGGCATGCCACCTTGCGAAACAAGCCTTTGATGATGCTGTT
TCGGAGCTGGATTCCCTGAATGAGGACTCTTACAAGGACAGTACCTTGAT
CATGCAACTTTTAAGAGACAACCTTACTTTGTGGACTTCTGATATCCCAG
AAGATGGTGATGATGAAAAGTTGGAAAGCACAGCCAAGGGTGGTCAAGCA
GAAGATGAGGTTGGCCGCTAAATAGTTTGTTCTTGTCAACTTTGGGTGAT
GCACCTCACAAACATTCATTGAGTTAATTGTTATTTTAGCTTGAGAGAAC
ATTTGAATCATTGTTATTGTTGGCTATTAGTCTTCTTAAGTTTCTGCAAC
AAACAACACTATTGATTTGGAACACATTATGATTCCACTTTTTTTTTCTG
CTGTTATAAATTAAATTGGTTGATAGTTGATACCACCAAAGATTAGCCCT
TGAAAAATTTTATCATGATGAGCCTGTCCTAATATTCAGATAGGTAATAG
TTAGACTATTAGAGCCTGTCCTAATTTGTGCAAGACAGTATTAACGTAGT
GAAAAAAAATTATTTTTTAAGTTAAAAAGAAGAGTGGTGCA
back to top
Protein Sequence

aradu.Aradu.11KMG.1 sequence

>aradu.Aradu.11KMG.1
MASSSKDRENFVYIAKLAEQAERYDEMVEAMKKVAKLDVELSVEERNLFS
VGYKNVVGSRRASWRILSKIEQKEESRGNEVNAKRIREYMHKVELELSKI
CSDIMIVLDEHLIPSTNVAESTVFYYKMKGDYYRYLAEFKDGDEKKEVAD
QSLKAYEAAATTAESELPPTHPIRLGLILNFSVFYYEIMNSPERACHLAK
QAFDDAVSELDSLNEDSYKDSTLIMQLLRDNLTLWTSDIPEDGDDEKLES
TAKGGQAEDEVGR.
back to top
Expression

Gene expression for aradu.Aradu.11KMG has been determined by its associated transcript, Adur24384_comp0_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.