Description
Gene Model Namearadu.Aradu.17F9I
Micro Synteny Viewaradu.Aradu.17F9I
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_GH3C9X
DescriptionDNA binding; nucleotide binding; nucleic acid binding; DNA-directed DNA polymerases; DNA-directed DNA polymerases; IPR006172 (DNA-directed DNA polymerase, family B), IPR023211 (DNA polymerase, palm domain), IPR025687 (C4-type zinc-finger of DNA polymerase delta); GO:0000166 (nucleotide binding), GO:0003676 (nucleic acid binding), GO:0003677 (DNA binding), GO:0003887 (DNA-directed DNA polymerase activity), GO:0006139 (nucleobase-containing compound metabolic process), GO:0006260 (DNA replication)
Protein domainsCoil G3DSA:1.10.287.690 G3DSA:3.30.420.10 G3DSA:3.90.1600.10 PF00136 PF03104 PF14260 PR00106 PTHR10322 PTHR10322:SF11 SM00486 SSF53098 SSF56672 TIGR00592
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.17F9I.1

Sequences
Gene Model Namearadu.Aradu.17F9I
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.17F9I.1 sequence

>aradu.Aradu.17F9I.1
ATGAGCAGCGGCGGCCGGAAACGCCGTGCTCCACCGACTTCGCATCCCTC
GCCGGCCACCCAGGCGAAAACCCAGGCCCTGTCTCAGGAAGATGATTTCG
TCGATGAGGATGTGTTCCTCAACGAAACCCTCATCACGGAGGACGAAGAG
TCCCTCATCCTCCGCGACATCGAGGAGCGCCAGGCCCTCGCTAACCGCCT
CTCCAAGTGGACCCGCCCTGCCCTCTCCTCCGACTACGTTTCGCAATCTT
GCAGCGTCCTTTTTCAGCAGCTGGAGATTGATTACGTAATTGGAGAGAGC
CACAAAGAGTTGATGCCGAATTCGTCTGGACCTGCTGCTATAATTAGAAT
ATTTGGTGTTACAAAGGAAGGACACAGTGTTTGCTGCAATGTTCATGGGT
TTGAACCATATTTCTACATCAGCTGCCCGCCTGGAATGGGTCCGGATGAT
ATCTCCCATTTTCATCAAACTCTTGAGGGAAGGATGCGAGAGGCCAATAG
AAACAGTAACGTGGGCAAATTTGTTCGTCGTATTGAATTGGTGCAGAGAA
GGAGCATTATGTATTATCAGCAGTCCAGTTCTCATCCCTTTCTCAAAATT
GTAGTTGCTCTCCCCACAATGGTTGCCAGCTGCCGTGGTATTCTTGATAG
AGGTATTCAGCTTAATGGTCTTGGCATGAAGAGCTTCATGACTTATGAAA
GCAATGTACTTTTTGCCCTTCGCTTCATGATTGATTGCAATATAGTTGGT
GCAAGAAGCTTGTCTAACTGTCAGTTAGAGTTTGATTGCTTGCATTCGGA
ATTGATTAGCCATGCTCCAGAAGGTGAATATTCAAAGATGGCACCATTTC
GCATATTGAGTTTTGACATTGAGTGTGCTGGTCGTAAAGGTCATTTTCCT
GAGCCTACCCATGATCCTGTTATCCAGATTGCTAATCTAGTTACATTACA
AGGAGAAGATCAGCCATTCATCCGTAATGTGATGACCCTTAATTCATGTT
CTCCCATAGTTGGTGTTGATGTGATGTCGTTTGATACAGAAAGAGAAGTC
CTTCTGGCCTGGAGGGATTTCATCCATGAAGTTGATCCTGATATTATAAT
TGGATATAACATCTGCAAATTTGACCTGCCATATCTTATTGAGAGAGCTC
AAGCCTTGAAAATAGCAGAATTTCCTATTCTGGGCCGTATCAGGAACAGT
AGGGTCCGAGTAAAGGATACAACTTTTTCATCTAGACAGTATGGAACCAG
AGAAAGTAAAGAAGTTGCTGTAGAAGGGAGAGTTCAATTTGATCTGCTCC
AGGTTATGCAAAGAGACTACAAATTAAGTTCTTATTCTTTGAATTCTGTT
TCAGCACACTTTCTTTCTGAGCAGAAAGAGGATGTTCACCATTCTATCAT
ATCTGATCTTCAGAATGGAAATGCAGAAACTAGGAGGCGCCTTGCTGTGT
ATTGTTTAAAGGATGCTTATCTCCCTCAACGGCTTTTAGATAAATTGATG
TTCATTTATAATTATGTGGAGATGGCTCGAGTAACAGGTGTCCCAATTTC
TTTTCTGCTTGCTAGGGGCCAAAGCATTAAGGCAAAGCAGAAGAACCTGG
TTCTTCCTAATGTAAAACAGGCTGGTTCAGAACAAGGAACATATGAAGGT
GCCACTGTATTGGAGGCAAGAGCTGGGTTCTATGAAAAGCCAATTGCTAC
TTTAGATTTTGCATCACTATATCCATCTATTATGATGGCCTATAATTTAT
GTTATTGTACCCTGGTGACTCCTGAAGATGTTCGGAAACTTAATCTTCCT
CCAGAATCAGTGAACAAAACTCCATCTGGGGAAACATTTGTTAAATCAAA
TTTGCAGAAGGGAATACTTCCTGAAATTCTTGAAGAGCTTTTAGCCGCGC
GTAAAAGGGCAAAAGCAGATTTGAAGGAGGCAAAAGATCCCCTTGAGAAA
GCCGTGCTTGATGGTAGACAACTGGCCCTGAAGATCAGTGCAAATTCTGT
ATATGGGTTTACTGGGGCAACTATTGGTCAGTTACCATGCTTGGAGATAT
CGTCAAGTGTAACTAGCTATGGTCGACAAATGATTGAGCACACAAAAAAA
CTTGTGGAAGATAAATTTACAACTCTTAATGGCTATGAACACACTGCCGA
GGTAATATATGGTGACACGGATTCAGTCATGGTTCAGTTTGGTGTCTCTA
CGGTAGAAGAGGCTATGAACCTGGGAAGAGAAGCTGCTGAATATATTAGT
GGAACTTTCACAAAACCCATCAAACTAGAGTTTGAGAAGGTTTACTTTCC
ATATCTCCTAATTAGCAAGAAGAGATATGCTGGTTTGTTTTGGACAAAAC
CAGACAACTTTGACAAAATGGACACTAAAGGTATTGAAACAGTTCGGAGA
GACAATTGTTTATTAGTCAAAAACCTTGTGAACGATTGCCTTCACAAAAT
ATTGATTGATAGGGACATCCCTGGGGCAGTTCAATATGTTAAAAATGCAA
TTTCAGATCTTCTTATGAACCGAATGGATTTATCACTTTTGGTTATTACA
AAGGGTTTGACAAAGACAGGAGATGATTATGAAGTGAAGGCAGCTCATGT
TGAACTTGCTGAAAGGATGCGCAAGCGAGATGCTGCCACTGCTCCAAATG
TTGGGGATAGAGTACCATATGTCATTATTAAAGCTGCAAAGGGTGCCAAG
GCTTATGAGAGATCAGAGGATCCAATATACGTCCTGGAGAACAATATTCC
TATAGATCCCCAATACTATCTTGAGAATCAAATCAGCAAGCCAATTCTAA
GGATTTTTGAGCCAATTCTGAAGAATGCTAGCAAAGAACTTCTCCATGGA
AGCCACACAAGATCTATTTCGATTTCTACTCCGTCAAACAGTGGCATCAT
GAAATTTGCTAAGAAACAGCTAACTTGCATTGGTTGCAAAGCTTTACTTA
GCAAGGGAAATCACACTCTTTGCTCACATTGCAAAGGAAGGGAAGCCGAG
CTGTACTGCAAAACAGTGACACATGTTTCCGAACTAGAAATGCTTTTTGG
GAGGTTGTGGACACAGTGCCAGGAATGTCAAGGTTCACTTCATCAGGACG
TTCTCTGTACAAGTCGTGATTGTCCTATTTTTTATCGACGAAAAAAGGCT
CAAAAAGATATGGCTGAAGCAAAGCTGCAACTTGACCGATGGAACTTCTA
AGATTTTGTCAAGATCCATAATTAGTTATTTCTCCGCATGAAAGCCAGAT
ACCTTAATTTTACAATCGTTCACATAGTCTAATTTGCTGTTTTGGGGATT
GAAGCACAACCTGTGTCTGCCTGCGGATTCGGAATCCTATGACATGCTCC
TGGAAGGAAGGTAAATGTAGTGAGGCTTGATTTTTGCGTGGTCTATATCT
AGTCTAGATATGAATTTTCTAGTGGGATAGTCTAGTTCATAATTTAAGCT
TGTATATTTGTTCATTAGTTCGGGCACGCTTAATGTAAAGGTTATACCAT
AAATTTGTTTCAGTAAATGACAAATTTGTTTCTAAAAGAATTGGCTACTT
AAATGTGAAGGTTATACCCTGCAAGAAATCGTATAAGTTGTCAATGAGTA
CTAAGTAGATATAATGATAATTTGACGATCAAATCCATGTTTTGAAATTC
TCTCGACAAAGTATATCTTAATTATGATCCTTGAA
back to top
Protein Sequence

aradu.Aradu.17F9I.1 sequence

>aradu.Aradu.17F9I.1
MSSGGRKRRAPPTSHPSPATQAKTQALSQEDDFVDEDVFLNETLITEDEE
SLILRDIEERQALANRLSKWTRPALSSDYVSQSCSVLFQQLEIDYVIGES
HKELMPNSSGPAAIIRIFGVTKEGHSVCCNVHGFEPYFYISCPPGMGPDD
ISHFHQTLEGRMREANRNSNVGKFVRRIELVQRRSIMYYQQSSSHPFLKI
VVALPTMVASCRGILDRGIQLNGLGMKSFMTYESNVLFALRFMIDCNIVG
ARSLSNCQLEFDCLHSELISHAPEGEYSKMAPFRILSFDIECAGRKGHFP
EPTHDPVIQIANLVTLQGEDQPFIRNVMTLNSCSPIVGVDVMSFDTEREV
LLAWRDFIHEVDPDIIIGYNICKFDLPYLIERAQALKIAEFPILGRIRNS
RVRVKDTTFSSRQYGTRESKEVAVEGRVQFDLLQVMQRDYKLSSYSLNSV
SAHFLSEQKEDVHHSIISDLQNGNAETRRRLAVYCLKDAYLPQRLLDKLM
FIYNYVEMARVTGVPISFLLARGQSIKAKQKNLVLPNVKQAGSEQGTYEG
ATVLEARAGFYEKPIATLDFASLYPSIMMAYNLCYCTLVTPEDVRKLNLP
PESVNKTPSGETFVKSNLQKGILPEILEELLAARKRAKADLKEAKDPLEK
AVLDGRQLALKISANSVYGFTGATIGQLPCLEISSSVTSYGRQMIEHTKK
LVEDKFTTLNGYEHTAEVIYGDTDSVMVQFGVSTVEEAMNLGREAAEYIS
GTFTKPIKLEFEKVYFPYLLISKKRYAGLFWTKPDNFDKMDTKGIETVRR
DNCLLVKNLVNDCLHKILIDRDIPGAVQYVKNAISDLLMNRMDLSLLVIT
KGLTKTGDDYEVKAAHVELAERMRKRDAATAPNVGDRVPYVIIKAAKGAK
AYERSEDPIYVLENNIPIDPQYYLENQISKPILRIFEPILKNASKELLHG
SHTRSISISTPSNSGIMKFAKKQLTCIGCKALLSKGNHTLCSHCKGREAE
LYCKTVTHVSELEMLFGRLWTQCQECQGSLHQDVLCTSRDCPIFYRRKKA
QKDMAEAKLQLDRWNF.
back to top
Expression

Gene expression for aradu.Aradu.17F9I has been determined by its associated transcript, Adur346_comp0_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.