Description
Gene Model Namearadu.Aradu.191FQ
Micro Synteny Viewaradu.Aradu.191FQ
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_3WT8X0
DescriptionRNA polymerase sigma factor; IPR014284 (RNA polymerase sigma-70 like domain); GO:0003677 (DNA binding), GO:0003700 (sequence-specific DNA binding transcription factor activity), GO:0016987 (sigma factor activity)
Protein domainsG3DSA:1.10.601.10 PF04542 PR00046 PTHR30603 SSF88946 TIGR02937
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.191FQ.1

Sequences
Gene Model Namearadu.Aradu.191FQ
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.191FQ.1 sequence

>aradu.Aradu.191FQ.1
TGTGTTTGATACAAGTTGAAGACTTGAACTATCCTTTGGTTCGCTTTTGC
TCCTCTATCACATTCCATTATTCTCAATATCTCTGCACAATCTCTCAGGC
TACTCAACACTCAACAACACTCTGTATATATAGTGACAATTTCAGAAGCA
TGGAATCCGCCAAAACAATGTTTATTACATCTCCACCCTTTCCTCCAAGA
ACTCTCCTTTCTTCTACCTCTTCGGCTTCAGGTCCACTTCCTACACTTGT
TTCTTTTTTACTTCAGGACAGGGTTATTTTACACATACATAATTTATATA
CATAATTTGTTGAATTTTGAGGGAAAAAGAAAATAAAGCTTTTGTTTTTT
GCCCCCAATTTGTGTGTCTGAGTTGAAGTTGGCACCTACAGTTCTGATGC
TTCATGAACAAGCTGCACCTTTAGTTGCTTCTTGGTCTTCAAGTTTTGCT
GCTCAGCATTTTCCTACCTCTGTTCTCTCGCAAGAGCAGCGTGATGAGTA
TAAGCCTCTGCTTCACTTGTATAAGGAAGATAAGAACTCTCAGGTTACAT
CAAATACAAGAAATGTGGATACGGGCTTGGTCCGCGATAAGGATAGCAAT
GATAATGCTGATCAGTTATTGCATCACTTTAGGCAGCAGTTGCAACTCTG
GTCACATTTGCAAAATGTATTGAAATCCTCAACAGGAGAAACTGCTGCTG
CTTCATCTCTGCAGCCCGATAGAGTTGATTCAGATAGACCTGCAGATGGT
TTGCAATTTGATGCAGTATCCCTCTCTAAGCAAGCTCTGTCGGCCGCAAA
ACAAGCAGCATTAGTGGCTGAAGAGATGAAAATGATTGAAGATGACGAAG
ATGATGATCCACTTCCTCTTGGTCTGGCTTCCACAAGCTTAGCTGACACT
TCAATTGGAAAGAATAAAATTGTGCGGTCAAGAAGGCTTCTAGAAAGGAG
ACTGAAGCAAAGAAAAGTTTCAAAGTCAAAATTTCTTGATGAAGAAAGTT
ATCTTGCAAGAAAATCAGACCTACAGGGAAGGCTACAAGTAGAAAAGAAG
ATAAAGGAAGGATTTGATCAAAATGATCCCCTGCGCTTGTTCTTGTGGGG
TCCTGAGACAAAGAAACTTTTGACCTCTGAAGAAGAGTCTCAATTGTTCG
TTCAGCTACAGGATTTTCTGAGATTAGAAGAAGTAAAGATCAGGCTCCAA
TCTCAATTTGGACGGGAACCAACTTTGATTGAATGGGCTGAAGGTGTGGG
TCTTAGCTGCCATGCCCTGCAGACACAGATCCATCATGGTAACATAATCA
GAGAAAAGATAATTAATGCCAATTTACGGATGGTTGTTCATATTGCTAAA
CAGTATCAGGGTCGTGGTCTCAGTCTTCAGGACTTATTGCAGGAGGGAAG
TATGGGACTTATGAAGAGTGTTGAAAGGTTTAAACCACGAGTTGGTTGCC
GGTTTGGTACCTATGCATACTGGTGGATAAGGCAAACAATTAGAAAGGCC
ATATTTCTACATTCCAGGTCAATCCGTCTGCCGGTAAAAATTGTTATTTC
TCTGTATTCTTGTTAGTTAAAATTAAGCATCCTTCTGCAGCGTCAGTATT
TCAGGAATTTGCTTTCTGTTGACAGATGATATTTTTCTTAGGGCGGAGAA
TTGATGTCATTATATTGCTCCTTTGTTTTTATTAGTAGGTTTGTTATTTA
TAAAGCAAACATCAATTCTATTTCAAGGTAACACGTAGTCTGTGCAAAAT
CTTCAGGAGAGTTTATATACCCTTTTGGGCAAGGTCATGGAAGCAAAGAA
ATTATTCATTCAAGAAGGAAATATTCACCCCAGTAAAGAAGAATTAGCAG
AAAGGGTAGGAATTACGGTAGAAAAGTTTGAAAAGTTGTTATTTTCTGCA
AGAATACCAATATCAATGCAGCAACCTGTGTGGGCAGACCAAGATACAAC
TTACCAGGTAGGGTACTCAAGTAAAGTAAATGTGACTTTCCCCTTGATAT
GGTATAATTTCGTAGATCTATTGAATGAAACAATGAAAAAATACTCTTTA
TCAATGTTTAGAACTGCTGACAGGCTCTTCTATTTTCCATTTAAATCGCT
AAGTATATGTATCGAGTCTTTTTCTGCCAATAATTGTATAAGCAAATTTG
TTGAAATATAATCGCTAAGAATTGAGAACGTAATATACTGCTAATAATCT
TGAATATCCATGGTTATTGCATTTTGCTGTGTGGTCGAAGGGAACAGGAG
CAACACCCTGTAGGTTTTTAAAGGTGTAATGGAGATTGTAGATCAGATGA
CATCAGAACAATTCAGTAAAAGATAGCAGTGTGTTTCAGTTTAGCTTTTG
AACTCATTGCTTGGGTGGTTGGTTTTGTAAACCAAGCCAATCTATATGAC
AATTGTTTCTCACAACATTGTAGTCTATCTTGATCGTTTACATTATTACT
TTTTTTTTTTTTTGAAGTTGTTAATATGTCCCACTTCGGTCTGCCAGTTT
TCATTGACCCATGGAGGCTGCTGACTGTCCAAAATTCTCTTGCATTTTTA
TCAAAATAGCCAATCATTTTTTGGAGGGAGGGGGGAATTTGGAATTTCAA
AATCCTATTTGTGTTTTCCATATGATTGTTTAATTGTTTTGTTAGGAACT
CTATTGGCCTGCTAGATTAATTCAAAACTTCTGCCATGCTCATCTTGGAT
ACTCTGGGATTAGTATTGATGAACACTCGGCCTTTTCAGTTTATCATCAT
GCAAATCTTCCAAGGTTAATAGTCTATGACCTTTTTCTTATATATGCAGG
AAATTACTGCAGATAGTGCAATTGAGATCCCAGGCTTGAGTGTCGAAAAA
GAGCTTATGAGGAGGCACGTGCGCAACCTCCTAAGCAACTTAAGCCCAAA
GGAGAAGAGGATAGTCAGTCTAAGATTTGGTATCGAGGATGGCCGCGAGA
AATCTCTGCAAGAAATTGGAAACGTACTTGGTTTGACAAAGGAGAGGGTC
CGACAGTTGGAGAGCCGAGCACTGAAGAAGCTCAAGCAGTGCCTTGAGTG
CGAAGGACTTCATGCATATGTGGACTTGATTGTATAGTGATAGTATAGTA
CTTGTGTATACACCAAGGTTATGCCAATTCATCTTACTTTGCTTTAAGTA
CAAAAGCAGTGACTATTTGAAGGAAAATCTTGACACTCAGCCATGGTAAT
TGAGGATGGAACTGCATGACCAACCAAAGAACTTGTACCGTTGTAAGAAA
GAAAATTCAAGTAAAAAAGAAAAGTATGAATATGGTTGATTTATATGCAC
ACTCAGATAATTGGTGTTTGTTTTCATTATTTTCTACAGATTTTGTTTTG
TTCATTTAGTTTTATTGGCATTAACGATAACATTGTTCTCAGGATTTTT
back to top
Protein Sequence

aradu.Aradu.191FQ.1 sequence

>aradu.Aradu.191FQ.1
SFCFLPPICVSELKLAPTVLMLHEQAAPLVASWSSSFAAQHFPTSVLSQE
QRDEYKPLLHLYKEDKNSQVTSNTRNVDTGLVRDKDSNDNADQLLHHFRQ
QLQLWSHLQNVLKSSTGETAAASSLQPDRVDSDRPADGLQFDAVSLSKQA
LSAAKQAALVAEEMKMIEDDEDDDPLPLGLASTSLADTSIGKNKIVRSRR
LLERRLKQRKVSKSKFLDEESYLARKSDLQGRLQVEKKIKEGFDQNDPLR
LFLWGPETKKLLTSEEESQLFVQLQDFLRLEEVKIRLQSQFGREPTLIEW
AEGVGLSCHALQTQIHHGNIIREKIINANLRMVVHIAKQYQGRGLSLQDL
LQEGSMGLMKSVERFKPRVGCRFGTYAYWWIRQTIRKAIFLHSRSIRLPV
KIVISLYSC.
back to top