Description
Gene Model Namearadu.Aradu.2DN0K
Micro Synteny Viewaradu.Aradu.2DN0K
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_PT48JG
Descriptionprotein TRANSPARENT TESTA 1 [Glycine max]; IPR013087 (Zinc finger C2H2-type/integrase DNA-binding domain); GO:0003676 (nucleic acid binding)
Protein domainsG3DSA:3.30.160.60 PF13894 PTHR11389 PTHR11389:SF387 SSF57667
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.2DN0K.1

Sequences
Gene Model Namearadu.Aradu.2DN0K
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.2DN0K.1 sequence

>aradu.Aradu.2DN0K.1
ATATATGTAGCTGTTACATTATACCCTGCACAGCTAAACATGAATCAAAA
GCAGCTTGAGCCACTACCTTTGCTAAGCAGCTTCCTTGGTTCTTCAACAT
GTTCATCATCAGAACTAAATCAAAATCTGAAAGAAGATGTGACAGTGGCC
TTACACATTGGGCTCCCTGACAATTCCCATGATAATCAAAATGTAGAACC
TCTCCAAGCTCCAAATAATTACTGGATACCAACAGAAGAGCAGATTATAA
TTGGTTTCAGCCACTTCTCATGTCCTGTTTGCCCAAAAACCTTCAACCGC
TACAACAATCTTCAGATGCATATGTGGGGACATGGGTCAGAATACAGAAG
AGGGCCAGAGTCACTGAAAAGAACACATCCAAGGCCATTGTTGGAGATAG
CATGCTACTGCTGCAAAGGAGGGTGCAAGAACAACATAGAGCATCCAAGA
GCAAAGCCTCTGAAAGATTTCAGAACACTGCAAACACACTATAAGAGGAA
GCATGGACCCAAACCCTTCTCATGCCGCAAGTGTGCAAAGAATCTGGCTG
TGAAAGGTGACTGGAGAACTCATGAGAAGAACTGTGGCAAACGCTGGCTT
TGTCTTTGTGGCTCTGACTTCAAACACAAGAGGTCTCTTAAGGATCATAT
CAAAGCTTTTGGCTTTGGTCATACT
back to top
Protein Sequence

aradu.Aradu.2DN0K.1 sequence

>aradu.Aradu.2DN0K.1
MNQKQLEPLPLLSSFLGSSTCSSSELNQNLKEDVTVALHIGLPDNSHDNQ
NVEPLQAPNNYWIPTEEQIIIGFSHFSCPVCPKTFNRYNNLQMHMWGHGS
EYRRGPESLKRTHPRPLLEIACYCCKGGCKNNIEHPRAKPLKDFRTLQTH
YKRKHGPKPFSCRKCAKNLAVKGDWRTHEKNCGKRWLCLCGSDFKHKRSL
KDHIKAFGFGHT
back to top
Expression

Gene expression for aradu.Aradu.2DN0K has been determined by its associated transcript, Adur44895_comp0_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.