Description
Gene Model Namearadu.Aradu.2SK6X
Micro Synteny Viewaradu.Aradu.2SK6X
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_7PCNRV
Descriptionprobable galacturonosyltransferase 15-like [Glycine max]; IPR002495 (Glycosyl transferase, family 8)
Protein domainsG3DSA:3.90.550.10 PF01501 PTHR32116 PTHR32116:SF2 SSF53448
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.2SK6X.1

Sequences
Gene Model Namearadu.Aradu.2SK6X
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.2SK6X.1 sequence

>aradu.Aradu.2SK6X.1
CATTTCCCGCGGCTTTGAATTTCGCAATTTTTTTCCACCGTCACTCTGAT
TTCTTTTATTTTTCTTCATCCAAACAAGAAAATCAGTACAATTTGCTCAC
TTTAATTTTCCTCGCAGAAATCGATTTCAGAAAAAGAAAAAAAGAAAAAG
GAAAATTCGAAACCCGTGAACTCATTGCTCTCATCACACCGTTGCAAATG
CGAAGCAAAACGACACGCGCACATTTTTTTTCTCTCTTTCTCTAGCTGAT
GAGTGATGGAGCAGTTATAGTAGTTGTTGAAGTGAGGAAGCAGTGTGAAG
TTTTCAGATCTGATTTTTGATTCAATCGTAGGGGAAAATGATAAGCTGGA
TGGAACTCAGAAGAAGATAATGAAGTTCTATGTATCTACCGCCGGGATAA
AGAGAGTCACCTTATCGTCGAAGGCCGCCGCAGCAGCTAACGCCGCCGCC
GGAGGAAAAGGATCGTCGAAGTCTACTGCCGCGGATGCCGCCGTTAGTCG
CCGGAGTTTTTCATCCCGGACTGTGCTGCCGGCGGTGGTTCTGTTCGGGA
TCGTGTCGCTCTTCGTCTTCGTGAGGATCGCGGTTTTGGTGCTCGAATCT
TCCGCTGTTTGCTCCTCTCTCGGTTGCGTGGGATGGAGGTTCTTCAGCGG
GGGTGACCCATCCCTGAAACTCAGAGATGAGCTGACCAGAGCGTTAATAG
AGGTAACTGATGACAACGTTAATGAAGGAGAAGTGGTGTCATTCAACGAG
CTTGTGAAAATGATGGCGTCTGAGCAAGACTTTAAGGCGTTTGCTATCAA
GACCAAAGCCATGCTGTTACAGATGGAGCGCAAGGTGCAATCAGCAAGAA
AGCAAGAATCAGTTTATTGGCATTTAGCTTCACATGGTGTACCAAAAAGC
CTACATTGCCTTTGTCTGAAATTGGCTGAAGAATATGCCGTAAATGCCAT
GGCCAGAACACGCTTACCTCCTCCTGAATATGTGTCTCGCCTTTCTGACC
CTACATTCTTCCACATAGTTCTCCTAACTGACAACGTCCTTGCTGCATCT
GTTGTTGTAACCTCTACTATTGAAAGTTCAGCCAGCCCTGAAAAATTGGT
TTTTCATATTGTTACGGACAAGAAAACTTACACTCCAATGCATGCCTGGT
TTTCCATAAACCCTGTGAAATCAGCAGTTGTTGAAGTCAAGGGATTACAC
CAGTACGATTGGTCTGAAGAAGTGAATGCTCGTGTCAAAGAGATGGTGGA
AACTACTCAATCAATTTGGAAACACTACTACAAGAATTATGCAGAAGAGG
ATGAACTACTCGACTATAATCAAGAGTATAAGAGATATTTGGAAGCTTTA
AGACCCAGCAGCCTTTCCTTGTTGAATCATCTTCGAATCTACATCCCTGA
GCTGTTTCCAGATTTGAACAAGGTGGTGTTGCTGGATGATGATGTTGTAG
TACAGCATGACATATCTTCGTTGTGGGAAATTAACCTTAATGGTAAAGTC
AGTGGTTCAGTATTCAAGTCATGGTGTTATAATGAGGAAAGCTGTTGCCC
TGGAAATAAATACGTGGACTTCTTGAACTTTTCACATCCTATCATATCAG
TCAACTTTGACCCTGACAAGTGTGCATGGCTCTATGGCATGAATATCTTT
GATGTTGAAGCTTGGAGGAGAACAAATATTACTGAAACCTACCATCGATG
GTTGAAACTAAATGTGAAGCATGGGCTATCATTGTGGAACCCAGGAGTGC
TTCCACCTGCATTGATTGCTTTTGATGGTCAAGTGCATCCGGTGGATTCA
TCATGGATTGTTACCGATTTAGGTTATCGCCATCAATCAGAACAAATTAG
AAATATCAGACATAGAATGGAAGATGCTGCTGTTGTTCATTTCAATGGCC
CTGCAAAACCATGGCTTGAAATTGGTTCACCTGAAGTTCGTGGTCTATGG
AATACATATGTTGATTTCTCAGATAAGTTTATTAGGAGCTGCAGGATTAC
AGCGTGAAACATTTTCCACCATCCACCTCCCCAGGCCAGTATTATTGATG
AGATTGAAGCAATTATGATGAAACCGTATGGGATCGGAGGGAAGAAGGTT
TTGCCTTCAGTCTCTGACTCATGCTAACAGATGATATATATAGGTGATGA
AGAACTACTACCACACAATATATACCTTATTAGAAAGAAGCAGTAGCTGC
ATCAGTTTAAGAATCGATCATATATAAAACATTGATAATCTAGTTGTCTA
ACAATGCTGTAAAAATTACTTGCTTTTTCTATATGGATCGGAGTAATTGT
TTCACTTGTATAGCATTATAATCAATAATCCAATAGGACGTGTGACGTTA
AAATACTTGATAAGTATTTGTTCTAATATAAAAGGAGTTCTGTTTATTGC
AAAACTACTTCTTAACATTACGTACACTAAATGTTTTCTCTTCCTTTTAC
ATAAT
back to top
Protein Sequence

aradu.Aradu.2SK6X.1 sequence

>aradu.Aradu.2SK6X.1
GSSVKFSDLIFDSIVGENDKLDGTQKKIMKFYVSTAGIKRVTLSSKAAAA
ANAAAGGKGSSKSTAADAAVSRRSFSSRTVLPAVVLFGIVSLFVFVRIAV
LVLESSAVCSSLGCVGWRFFSGGDPSLKLRDELTRALIEVTDDNVNEGEV
VSFNELVKMMASEQDFKAFAIKTKAMLLQMERKVQSARKQESVYWHLASH
GVPKSLHCLCLKLAEEYAVNAMARTRLPPPEYVSRLSDPTFFHIVLLTDN
VLAASVVVTSTIESSASPEKLVFHIVTDKKTYTPMHAWFSINPVKSAVVE
VKGLHQYDWSEEVNARVKEMVETTQSIWKHYYKNYAEEDELLDYNQEYKR
YLEALRPSSLSLLNHLRIYIPELFPDLNKVVLLDDDVVVQHDISSLWEIN
LNGKVSGSVFKSWCYNEESCCPGNKYVDFLNFSHPIISVNFDPDKCAWLY
GMNIFDVEAWRRTNITETYHRWLKLNVKHGLSLWNPGVLPPALIAFDGQV
HPVDSSWIVTDLGYRHQSEQIRNIRHRMEDAAVVHFNGPAKPWLEIGSPE
VRGLWNTYVDFSDKFIRSCRITA.
back to top
Expression

Gene expression for aradu.Aradu.2SK6X has been determined by its associated transcript, Adur6039_comp2_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.