Description
Gene Model Namearadu.Aradu.302GN
Micro Synteny Viewaradu.Aradu.302GN
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_JKGY76
DescriptionIron ion binding / oxidoreductase/ oxidoreductase protein n=1 Tax=Genlisea aurea RepID=S8C9J7_9LAMI; IPR005123 (Oxoglutarate/iron-dependent dioxygenase); GO:0005506 (iron ion binding), GO:0016491 (oxidoreductase activity), GO:0031418 (L-ascorbic acid binding), GO:0055114 (oxidation-reduction process)
Protein domainsPF03171 PTHR10869 SM00702
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.302GN.1

Sequences
Gene Model Namearadu.Aradu.302GN
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.302GN.1 sequence

>aradu.Aradu.302GN.1
ACAACGCTTCCAAATTCTGATTTCGTATTTTGAATTTATCTTCATGCAAA
AGACGCAAAACAGTGTTACAGATTAAGCTTTTTGGCCTGAAGAAAGGGTA
GCCATAGAACTATGATGAAGCGTATATATTCACAAACACCATTCAATTCT
ACATTATTTGAAGCATGGCAAAAGCAAAATACACGAATCCGAAGGCGCAG
TTGAAGAAATGGATCTCGTTGAGGAAGCTGGTTTTGCCGATGCTTTTGAT
TTTCACGATTGTGCTTCTGGTGTTACTTTCTATCGGAGTTGTTAATCTTC
CTATTACCGCTAATGATTCTCCGATCAAGGATATCGGTGCTGTTAGGCGG
CGCAGAACTTCTGAGAGAGGTTACGGTTTGGTAGAGCAAAAGAAAAAGTG
GACCGAAATTCTTTCGTGGGAGCCAAGAGCTTTCATGTACCACAATTTCC
TGATACTTGCTCCTGAGAGACTAGTGGTGGTAATGCAATTCTATACAATC
CATGCCTCCAGTGATCGTACTAGCTCAGGAGCGTTTCTGAGAAGAGGATT
GGACAAAATTGTCCAAAGGATAGAAAAAAAGATTGCTGATCTTACTTTCG
TACCAATAGAGAATGGAGAAGGACTTCAGGTTCTTCACTATGAAGTTGGC
CAAAAATATGAACCTCACTTTGATTACTTCTTAGATAAGGTCAACACTAA
GGATGGAAACCACCATGTTGAAGAAGGTGGCGAGACCGTATTTCCTGATG
CCAATGTAAGTTTTAGTTCTGTTCCATGGCAGAATGATTTGTCTGAATGC
GCTAAAAATGGTCTCGCGGTGAAGCCAAAAATGGGTGATGCTATATTGTT
TTGGAGCATGAAGCCAGATCTCACCCTAGATCCTTCTTCTCTACATGGTA
GTTGCCCTGTTATTAGAGGAAATAAATGGGCTTCAGCAAAGTGGCTACGT
CTTGGGGTGTTCAACTAATAAGGATATTATTAAGCCATCTCGTGTGCAGA
TACTTGTAGAGAGTAAGGATCATTCCAATGCACTCTTACAAGAATTCAAA
AATGATTTTTATCTTAAAGTATAAGCGACAATTTCATCCATTTCGTGCAA
CAATTTCCTCGCTCAACATATTTGCATAGGATTGCATTATAAAAATACTT
TATATT
back to top
Protein Sequence

aradu.Aradu.302GN.1 sequence

>aradu.Aradu.302GN.1
MAKAKYTNPKAQLKKWISLRKLVLPMLLIFTIVLLVLLSIGVVNLPITAN
DSPIKDIGAVRRRRTSERGYGLVEQKKKWTEILSWEPRAFMYHNFLILAP
ERLVVVMQFYTIHASSDRTSSGAFLRRGLDKIVQRIEKKIADLTFVPIEN
GEGLQVLHYEVGQKYEPHFDYFLDKVNTKDGNHHVEEGGETVFPDANVSF
SSVPWQNDLSECAKNGLAVKPKMGDAILFWSMKPDLTLDPSSLHGSCPVI
RGNKWASAKWLRLGVFN.
back to top
Expression

Gene expression for aradu.Aradu.302GN has been determined by its associated transcript, Adur29274_comp0_c0_seq2 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.