Description
Gene Model Namearadu.Aradu.31IUC
Micro Synteny Viewaradu.Aradu.31IUC
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_54GTR1
Descriptionputative indole-3-acetic acid-amido synthetase GH3.9; IPR004993 (GH3 auxin-responsive promoter)
Protein domainsPF03321 PTHR31901 PTHR31901:SF0
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.31IUC.1

Sequences
Gene Model Namearadu.Aradu.31IUC
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.31IUC.1 sequence

>aradu.Aradu.31IUC.1
CTCATCCTCTTCACCCCTTCACTCCCACCATTAACAAACATAAACACTTT
CATTCTCGTCATTTTCTTCCTTATCCTTTTCTTTCTATTTTCTTCCCACT
TAATAAACAACGAACTGGTTACCATGCCTGAGGCACCAAAAGAGTATGAC
CTGGCGGGTGAGAACAAGAGGGTCCTGGACTTCATCGAGTCTGTCACTGC
AAACGCCGACGTTGTGCAGAAAGACATCCTCGATGAGATCCTGTCCCGTA
ATGTCGGTGTAGAGTATCTACGCCGGCATGGCCTTGAAGGCCGCACGGAC
CGGGACACCTTCAAGAAGCTTCTCCCCGTCATAACTTACGAGGACATCCA
ACAAGATGTTCTTCGCATAGCCAATGGAGACACTTCTCCAATACTCACCT
CAAAGCCTATCTCAGAGTTTCTCACTAGCTCTGGGACATCAGGAGGAGAG
AGAAAGCTGATGCCAACAATTGAAGAAGAGCTAGGAAGAAGGTGCTTGCT
TTATAGCCTATTAATGCCAATAATGAGTCAATTTGTGCCTGACCTAGAAA
AGGGCAAAGGCATGTACCTTATGTTCATAAAATCCGAGTCTTGGACACCT
GGGGGGATAGTGGCTCGGCCAGTCCTCACAAGCTACTACAAGAGCCCTTA
TTTTAAGGACAGACCCTATGACCCATACACTAACTACACAAGCCCAAATG
AAACCGTCCTTTGCCCTGATTCCTACCAAAGCATGTACTCACAACTTCTT
TGTGGCCTTTGCCAAAACAAAGAAGTTTTGAGGGTTGGAGCTGTTTTTGC
TTCCGCTTTTATTAGGGCCATAAGGTTTCTTGAGAAACATTGGGTCCTAC
TTTGTAACGACATAAGGACCGGATCTCTAAATCCCAATATCATCTCTGAC
CAGACAGTCAGAGACGCCGTGAAAAAGATTCTTGATAAACCCAATCCGTA
TCTTGCGGATTTTATCGAGAGTGAGTGTAGTAAGAGTTCATGGCAAGGGA
TTATCACGAGATTGTGGCCCAACACAAAGTATGTGGATGTTATTGTGACA
GGAACTATGTCACAATATATACCAACATTGGATTACTATAGCAATGGGCT
ACCACTTGTGTGTACCATGTATGCATCAAGTGAGTGTTACTTTGGTGTGA
ATCTAAATCCTCTTTGCAAACCAAGTGAGGTGTCCTACACCCTCATCCCT
TCAATGTGCTACTATGAGTTTTTGCCGGTTAACCGGAGCGACGAGGTCAC
CGGTTCGCTTCACATGCCAAAATCGCTCAATGAGAAGGAGCAACAGGAGC
TGGTGGAGCTTGTGGATGTTAAGCTTGGCCAAGAATATGAGCTTGTGGTC
ACAACTTTTGCCGGCCTCTATAGGTATAGAGTGGGTGATGTCCTAAGGGT
GTCGGGATTCAAGAACAAGGCGCCACAATTCAACTTCGTCTGCCGGAAAA
ATGTTGTCCTAAGCATAGATTCCGACAAGACCGATGAGACGGAGCTCCAA
AATGCCATGAAAAATGCCGTGACACACCTCCTCCCCTTCGATGCGACCGT
GGTCGAATACACCAGTTATGCGGACACCACAACCATCCCGGGCCACTATG
TGCTCTATTGGGAACTCACTCTAAACGGTGCGACACCAATCCCACCGTGC
GTGTACGAGGATTGCTGTCTTACCGTAGAGGAGTCCCTCAACAGTGTGTA
CCGGCAAGGACGTGTGTCCGACAAGTCGATTGGGCCACTTGAAATAAGGA
TTGTGGAGCAAGGAACCTTTGATAAGCTCATGGACTATGCCATAAGCTTA
GGTGCATCAATTAACCAATATAAGGCACCTAGGTGTGTTAAGTTTCCACC
TGTGCTGGAGCTATTGAACTCAAGGGTGGTTGAAAGGTTCTTTAGCCCAA
AATGTCCAAAATGGGTCCCCGGACACAAGCAATGGAGCAATGGTCAGAAC
TGAATGAATGAAGACTGAAGTAGCATGATTAGAAAAAATATGAACAACTA
TGTTATGTGGTTGTGTAGGTTTTTTTTCAACAATGTTCCTATATGGGCAT
CTTAGGTTAATTAAGGCTTCTTAGGCCCCCTCTCTCTTTAAGTTATAGTT
GATGTTTTTAATTAATAAGTTGCATAATGAATAGTTGTGATGTGGAACTT
AAATTAGCCAATGTAAAAAAGCAACAAATTCCACCCTACTCTAAATCGTG
TTTCTTTGTATCCAGTTAAATTGAAC
back to top
Protein Sequence

aradu.Aradu.31IUC.1 sequence

>aradu.Aradu.31IUC.1
MPEAPKEYDLAGENKRVLDFIESVTANADVVQKDILDEILSRNVGVEYLR
RHGLEGRTDRDTFKKLLPVITYEDIQQDVLRIANGDTSPILTSKPISEFL
TSSGTSGGERKLMPTIEEELGRRCLLYSLLMPIMSQFVPDLEKGKGMYLM
FIKSESWTPGGIVARPVLTSYYKSPYFKDRPYDPYTNYTSPNETVLCPDS
YQSMYSQLLCGLCQNKEVLRVGAVFASAFIRAIRFLEKHWVLLCNDIRTG
SLNPNIISDQTVRDAVKKILDKPNPYLADFIESECSKSSWQGIITRLWPN
TKYVDVIVTGTMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLCKP
SEVSYTLIPSMCYYEFLPVNRSDEVTGSLHMPKSLNEKEQQELVELVDVK
LGQEYELVVTTFAGLYRYRVGDVLRVSGFKNKAPQFNFVCRKNVVLSIDS
DKTDETELQNAMKNAVTHLLPFDATVVEYTSYADTTTIPGHYVLYWELTL
NGATPIPPCVYEDCCLTVEESLNSVYRQGRVSDKSIGPLEIRIVEQGTFD
KLMDYAISLGASINQYKAPRCVKFPPVLELLNSRVVERFFSPKCPKWVPG
HKQWSNGQN.
back to top
Expression

Gene expression for aradu.Aradu.31IUC has been determined by its associated transcript, Adur12545_comp0_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.