Description
Gene Model Namearadu.Aradu.3V31S
Micro Synteny Viewaradu.Aradu.3V31S
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_4SXM1R
Descriptionketol-acid reductoisomerase; IPR013023 (Acetohydroxy acid isomeroreductase), IPR016040 (NAD(P)-binding domain); GO:0004455 (ketol-acid reductoisomerase activity), GO:0008652 (cellular amino acid biosynthetic process), GO:0009082 (branched-chain amino acid biosynthetic process), GO:0016491 (oxidoreductase activity), GO:0050662 (coenzyme binding), GO:0055114 (oxidation-reduction process)
Protein domainsG3DSA:1.10.1040.10 G3DSA:3.40.50.720 PF01450 PF07991 PTHR21371 PTHR21371:SF4 SSF48179 SSF51735
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.3V31S.1

Sequences
Gene Model Namearadu.Aradu.3V31S
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.3V31S.1 sequence

>aradu.Aradu.3V31S.1
CTAATAAAGAATTTGGCCCACATTAAACCAGTACATCAGGGCGCACGTTA
GCCAGTCCACTACGTGTCAACAGTATAGAGACTAAGCTCATTACATCTCT
CCGCTCTCTCGCACCTTTGCTCTTCTTACAAACTTTGTCAATGGCTGCTG
CTGCCGCTTCTTCAAACACCATAGCACTAGCAGCAGCTAAGCCCTTAACC
AAAGCCCCTACTCCAACCGTTTTCAACGGTCTCGCATTCTCCGTTAACAA
CCTCACTCCAAGACCCCTCGCTGCTCGCCACGTCAACGGTGCTGCCCTCG
CTGCTAAAATGGTTTCGTCGGCGCCGGCGGTTTCTCTCCCTGCCTCGCTT
GATTTCAACACTTCTATCTTCAAGAAGGAGAAGATTAGCCTCGCTGGACA
CGATGAGTACATTGTGAAAGGAGGGAGAGATTTGTTTCATTTGTTGCCGG
ATGCTTTCAAGGGGATTAAGCAGATTGGTGTTATCGGATGGGGTTCACAG
GGACCTGCACAGGCCCAGAATCTTCGGGACTCGCTCGCTGAAGCAAAGTC
TGACATAGTGGTTAAGATTGGACTCAGGAAAGGTTCTAGTTCCTTTAATG
AAGCTCGGGCAGCTGGTTTCAGTGAGGAAAATGGAACTCTAGGTGACATA
TGGGATACTATCTCAGGCAGTGATCTTGTCTTGCTCTTAATTTCAGATGC
TGCACAGGCAGATAGTTATGAAAAAATATTTTCGCACATGAAGCCAGGCA
GCATACTTGGATTGTCCCATGGGTTTCTTCTTGGGCATTTACAGTCACTG
GGAATTGATTTTCCCAAGCACTTCAGTGTAATTGCTGTATGTCCAAAGGG
GATGGGTCCTTCAGTGAGGAGGCTCTATGTTCAAGGCAAAGAGATAACAT
GGTCTGTTGCCCTTGGTTCTCCCTTCACATTTGCGACTACATTGGAGATG
GAATACAGGAGTGACATATTTGGAGAGAGAGGCATTTTACTCGGTGCTGT
TCATGGAATTGTGGAGTCCTTGTTTAGGAGGTACACTGAAAATGGAATGA
GTGAAGATCTGGCTTATAAGAACACTGTTGAGTCCATAACAGGAATCATA
TCTAAAATCATATCAACTAAGGGCATGTTGGCTGTATACAATTCTTTATC
TGAAGATGAAAAAAGAGAATTCGAGACGGCATATAGTGCTTCATATTATC
CCTGCATGGAGATTTTGTACGAGTGCTACGAGGATGTAGCTAGTTGTAGC
GAGATTCGCAGTGTTGTTTTGGCTGGGCGTCGCTTTTATGAGAAAGAGGG
TCTACCTGCCTTTCCCATGGGCAAAATTGATCAGACCCGCATGTGGAAAG
TTGGTCAGCGTGTCCGATCTACAAGGCCAGCAGGTGATCTAGGGCCATTA
TATCCATTTACTGCTGGTGTATATGTGGCATTGATGATGGCTCAGATTGA
GATCTTGAGGAAGAAAGGGCATTCCTACTCTGAAATCATCAATGAGAGTG
TCATTGAGTCTGTTGATTCATTGAACCCTTTCATGCATGCTCGTGGTGTA
TCTTTCATGGTTGATAACTGTTCAACCACAGCAAGGTTGGGTTCAAGGAA
ATGGGCTCCTAGATTCGATTACATCCTAACCCAGCAGGCCTTGGTGGCAG
TAGACAGTGGTGCGCCTACTAACCGGGACCTGATCAGCAACTTCTTGTCA
GATCCAGTCCATGGAGCCATTGAAGTATGTGCTGAACTGAGGCCTACCGT
GGATATTTCAGTCCCACCAGATGCGGATTTTGTCCGTCCTGAGTTGCGCC
AGTCTGGAAACTAGAACATCAAGCAGTTGATGCTTTTTCTTGAGCTGATT
CAATTTCGGAATGCTCAGAATAGCCTGTATGCTAGTAGTGAGTGGATTTT
GTTTGAGTTCTAGTATGGAACATCTGTATTAATTCTCTCTAGTTTTAAAG
ATTTTGCGGATGAGGAATGTTGCGTATTAGGTAATATCGTACTATAAATG
AGCTGATCAGTTATGTTTACAAGTATGTGGAGTGTTATTTGTGGGTATCA
TGGCATCAGTCCAATAAAATTTCTTAGAGCTTTATTCCATATAGATAACT
GAATTGACTTACGGTGATTTTTAGTTTAGTGTAGATAACGTGTTAAATTT
TTTAATATAAATATAAAATGGAGATTTTTTATAGGGAAACCAAATGATTT
TCTCCATATTTTCATAATTGACAGGTAGAGGTTGAGAACAGATGTTACAA
CTGG
back to top
Protein Sequence

aradu.Aradu.3V31S.1 sequence

>aradu.Aradu.3V31S.1
STSGRTLASPLRVNSIETKLITSLRSLAPLLFLQTLSMAAAAASSNTIAL
AAAKPLTKAPTPTVFNGLAFSVNNLTPRPLAARHVNGAALAAKMVSSAPA
VSLPASLDFNTSIFKKEKISLAGHDEYIVKGGRDLFHLLPDAFKGIKQIG
VIGWGSQGPAQAQNLRDSLAEAKSDIVVKIGLRKGSSSFNEARAAGFSEE
NGTLGDIWDTISGSDLVLLLISDAAQADSYEKIFSHMKPGSILGLSHGFL
LGHLQSLGIDFPKHFSVIAVCPKGMGPSVRRLYVQGKEITWSVALGSPFT
FATTLEMEYRSDIFGERGILLGAVHGIVESLFRRYTENGMSEDLAYKNTV
ESITGIISKIISTKGMLAVYNSLSEDEKREFETAYSASYYPCMEILYECY
EDVASCSEIRSVVLAGRRFYEKEGLPAFPMGKIDQTRMWKVGQRVRSTRP
AGDLGPLYPFTAGVYVALMMAQIEILRKKGHSYSEIINESVIESVDSLNP
FMHARGVSFMVDNCSTTARLGSRKWAPRFDYILTQQALVAVDSGAPTNRD
LISNFLSDPVHGAIEVCAELRPTVDISVPPDADFVRPELRQSGN.
back to top
Expression

Gene expression for aradu.Aradu.3V31S has been determined by its associated transcript, Adur31032_comp0_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.