Description
Gene Model Namearadu.Aradu.42KZ7
Micro Synteny Viewaradu.Aradu.42KZ7
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_MCY3Q4
Descriptionuncharacterized protein LOC100786732 [Glycine max]
Protein domainsCoil
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.42KZ7.1

Sequences
Gene Model Namearadu.Aradu.42KZ7
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.42KZ7.1 sequence

>aradu.Aradu.42KZ7.1
ATGGCTGAAAATTTGGACGACGGTGAGTTTTGGCTTCCGCCGCAGTTTCT
CGTCGACAACGACGACGACGGAACGGCCTCGTTCCCCTCGAACGAAGACT
CGCTGTACCACTCTAGTGGCGACGATTTTGTGTTTCCCTTCGGCTTCTCT
ACCGGGGCCGCTTCCTCTGACCTAAGCTCTCCCATCAGTGGCTCCAGCGA
GACCGAGAGCGACGAGGACGACCATCTCCACCGAGTCGCCGAGTTGACTC
ACCAAGTTGCTCACTCTACCGGCGGTTACGCATCTGGTTCGCCACAATCG
ACGCTATGCGCCTTACGGTGCGGGAAGGGGTCGAGCGAGGGAAGTCCTAG
CAGCGTTTGCAACCTCTGCTCCGCAAAGGCCACATGGGATCTCCTGCACG
CGGCTGCAGGGGAAGTCGAAAGGATGCGCCTCTCCCAACAACAACAACAA
CAGCAACCACAATTACCATCTTACCCCTACAACCCTTCCCCTTCCATTCC
CAACACAGCCGCCGGCGCCAATTCGGACTTTTCTTTCTACACTCAGCAGG
CACTCTCCCACCAGAAGCAGTTTCAAATTGCACAAATTCAGATGCTGAGG
CAGCAACACGAATCAGTGTGGGGTGGTAAAGGTGTTTACCAACAGAGGCA
GAGTAACCAAATGGGAGCAAGAAACAGAGGAGGAAGAAGTGTTAGGCCAC
TTGGCTTGTCTCCATCTGCATGGCCTTCGTTACATGCTGCCAAGAACCAG
AACAAGCACCACAAGCACCATAATCAGCAGCAACAGCAGCAGTACGGTTC
TGGAATGAGGGCTGTGTTCCTCACCAACCCTTCCACTACCAGGGAATGTG
CTGGCACTGGCGTTTTCCTCCCCCGTCGTGTTGATACCCCTGAAACCAAA
AAGAAGCCAGCGTGTGCGACGGTGTTGGTTCCAGCTAGAGTGGCGCAAGC
CCTAAATCTGAATGTTGATGACATGGTGGGGTGCCTGCCGCATCGATTCA
ATTCCAGTTCAAACATGGAAGAACATGTTGTTAGTCCAAGGCTCAGAAGC
AATTATGTCCATACGTCTCAGCAGAAGCGCAACGTGAGGCCCCAGCACGC
ACTCAACAGTAACAATGAAATCAAGCTGCCGCAGGAGTGGACGTATTGAA
GTTAAATTCATATTCATCCCTTTTGTTTGTATGGGGAAAAATGGAATAGT
AAATCACTTCTTTTGTTATTTGGTTTTTCGAATTAGAGGGATAAAATCTA
GGGTAGGAAATTGAAAGTGTTTAGAAGGGAAATGTAGTGTAGTCTTCTTC
TACAGGGGGTATGTGGGTTG
back to top
Protein Sequence

aradu.Aradu.42KZ7.1 sequence

>aradu.Aradu.42KZ7.1
MAENLDDGEFWLPPQFLVDNDDDGTASFPSNEDSLYHSSGDDFVFPFGFS
TGAASSDLSSPISGSSETESDEDDHLHRVAELTHQVAHSTGGYASGSPQS
TLCALRCGKGSSEGSPSSVCNLCSAKATWDLLHAAAGEVERMRLSQQQQQ
QQPQLPSYPYNPSPSIPNTAAGANSDFSFYTQQALSHQKQFQIAQIQMLR
QQHESVWGGKGVYQQRQSNQMGARNRGGRSVRPLGLSPSAWPSLHAAKNQ
NKHHKHHNQQQQQQYGSGMRAVFLTNPSTTRECAGTGVFLPRRVDTPETK
KKPACATVLVPARVAQALNLNVDDMVGCLPHRFNSSSNMEEHVVSPRLRS
NYVHTSQQKRNVRPQHALNSNNEIKLPQEWTY.
back to top
Expression

Gene expression for aradu.Aradu.42KZ7 has been determined by its associated transcript, Adur42287_comp0_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.