Description
Gene Model Namearadu.Aradu.49R8H
Micro Synteny Viewaradu.Aradu.49R8H
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_9K9SH9
DescriptionDUF674 family protein; IPR007750 (Protein of unknown function DUF674)
Protein domainsPF05056
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.49R8H.1

Sequences
Gene Model Namearadu.Aradu.49R8H
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.49R8H.1 sequence

>aradu.Aradu.49R8H.1
ATGCATACCCCAACTCTCAGAGCAAGCTGTTGTGGGATCATGGCATCATC
CGCATCCACAAAAGTGAGCATGAAGCTTCTGATCGACACAAAGTGCAAGA
GAGTTCTGTTCGCCGAAGCCTCCAAGGAAGTGGTGGACTTCCTTTTTAAC
CTGCTTCAGTTGCCACTCGGTGCAGTGGTGAAGCTTCTAACAGAAAAATC
CATGGTGGGTGGCATAGGCAATCTCTATAAGAGCGTGGAGGGTCTTGGTG
ACAGTTTCTTGCAACCAAACCTATCCAGAGATGTTCTGCTGAATCCAGGT
TTCCCTTCATCGTCAACCGCCATCTCTGGTCTTCTTCTTCCATCATCAGC
TGCTGCCACGGGAAGGGTACATGGGAGTAGTGGCTTTGTGAAAGAGGTTG
TGACGTACATGGTGATGGACGATTTGGTCATTCAACCCATGTCAACCATT
TCAAGCATCACTCTGCTGAACAAGTTCAATGTGAAGGAGGTTGGTGCCTT
GCAAGAGAAGGTGGTCGAGCTTGGAATGAACGAGGGCTTAAGGCTACTGA
AGGCCTCATTGCAGTCGAAGATGGTGTTGACAAGCGTCTTCCTCAAGACC
ATGACGAGCAAGACACCCCCTACAAATAGTTTGAGTGTGAAGCTTCTGAT
ACACACAAAGCGTAAGAAAGTGCTGTTTGCAGAAGCCTCTAAGGATGTAG
TGGATTTCCTCTTTACCTTGCTTCAGTTGCCACTTGCTACCGTCGTCAAC
ATTTTAACCAAGGAAACTGCCTCTGGTTGCTTAGGAAATCTCTATTCCAG
CGTTGAAAACCTCAACCGTGTTTACATGCAACCAAACCTATCTAAGGATC
TTCTTCTTCATCCAACCATTATTCTTCCCTCCTCACCTTCCATCTCCGGA
ATCCTCCCTTCAGCTGCTAGAAATCATTCCGACGAGACAACTCCAAAGAT
TTACAAATGCTCGAGCGGTTATATTGGTTGTATGACCACTGTAACAGATG
TGTATAACTCTCTTTGTAGCGTGTGTTACTCTGGTCGTACGACGACGGAG
CTGAAGTATATCAAGGGTGAAGTCACCGCCACGGCAAGGGCGGGAACAGC
ACCAGCTACTTCTGGTCATAGTAATAACGGGTTTGTGAAAGAAGTAGTAA
CTTACATGATCATGGATAATCTTGTCATTCAACCCATGTCAATCCTCTCC
GGCCTCACCATGCTTAACCAGTTCAATGTCTATGATGTTGGTGCCTTGAA
AGAAGCTGTTGTTCAACTCGGCATGAATGAGGGCATACAGCTACTTAAGA
CATGTATGGAAAAGTCCGACAAGGTTCTCACAAGCCTTCTGATAGACACA
AAGGCTTCTAAGGAAGTGGTGGATTTTCTCTTTACCTTTCTTCAGTTGCC
ACTTGCTATCGTCGTCAAGCTTTTAACCAAGGAAGATGCCGTTGGTTGCT
TAGGTAATCTCTATTCTAGCGTTTTAAACCTGAACCATATTTACATGCAA
CCAAACCTATCTAAGCATCTTCTCCTTCGTCCAACCGTTCTTGGCCCTAC
TTCACCTCCCATCTCCGGCAAAGCTGTACGTGTGCTATAA
back to top
Protein Sequence

aradu.Aradu.49R8H.1 sequence

>aradu.Aradu.49R8H.1
MHTPTLRASCCGIMASSASTKVSMKLLIDTKCKRVLFAEASKEVVDFLFN
LLQLPLGAVVKLLTEKSMVGGIGNLYKSVEGLGDSFLQPNLSRDVLLNPG
FPSSSTAISGLLLPSSAAATGRVHGSSGFVKEVVTYMVMDDLVIQPMSTI
SSITLLNKFNVKEVGALQEKVVELGMNEGLRLLKASLQSKMVLTSVFLKT
MTSKTPPTNSLSVKLLIHTKRKKVLFAEASKDVVDFLFTLLQLPLATVVN
ILTKETASGCLGNLYSSVENLNRVYMQPNLSKDLLLHPTIILPSSPSISG
ILPSAARNHSDETTPKIYKCSSGYIGCMTTVTDVYNSLCSVCYSGRTTTE
LKYIKGEVTATARAGTAPATSGHSNNGFVKEVVTYMIMDNLVIQPMSILS
GLTMLNQFNVYDVGALKEAVVQLGMNEGIQLLKTCMEKSDKVLTSLLIDT
KASKEVVDFLFTFLQLPLAIVVKLLTKEDAVGCLGNLYSSVLNLNHIYMQ
PNLSKHLLLRPTVLGPTSPPISGKAVRVL.
back to top
Expression

Gene expression for aradu.Aradu.49R8H has been determined by its associated transcript, Adur9344_comp0_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.