Description
Gene Model Namearadu.Aradu.4P1MR
Micro Synteny Viewaradu.Aradu.4P1MR
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_7SJKT1
Descriptiontranscription factor bHLH74-like [Glycine max]; IPR011598 (Myc-type, basic helix-loop-helix (bHLH) domain); GO:0046983 (protein dimerization activity)
Protein domainsG3DSA:4.10.280.10 PF00010 PTHR12565 PTHR12565:SF7 SM00353 SSF47459
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.4P1MR.1

Sequences
Gene Model Namearadu.Aradu.4P1MR
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.4P1MR.1 sequence

>aradu.Aradu.4P1MR.1
TGAGAATGAATGAGCCTCTTCTTTCTTCTTTTACTTTAACTTGTTAGCTA
ACACTCTCTCTCTCTCTCTCTCAGTCCCTATAAAGCTGCAAAGCCTATTT
TGTTCCTTGTTGAGTGCTGCAAGATATCTCATATCTCTCGAGCCAACCTT
AGTCAAAATTCACTTTCCCCTTTAATCATCATACACTTTTGTTTATTTCA
ACTCCATTATTATATCCTTACACTCCATGTAGCAGTACCACTGCTCCTAG
GATATATATATATATACATTGTTTATTTTCTCTTTTCAGAAGATGAGTAG
TGATGTTGAAAATGCCATGAGGCTTCAACAGGAAGAGAAAAAGGGCATTC
TGATGAGTTGTCCTTCTTCATTGGGTTTGGGGACAAGTGGTTCAGAAATG
GCAAGTTCTAATTCTGAGCCTTCAAATGTAGCTAATCCCTTTCTTGCTTC
CTCTGCTTGGGATCCTCTTACTCCTTTAACTCAACTTCAAACTACTAATA
CTACTACTCTTGTTGGAGACCCTTCTACTTCTTCAATACCAATACCAATA
CCAATGGTTTCTCATCATAATAATGAATTCTCCAACTCATTGTTGTACAC
TCTTGTTTTGGAAAACCAGCAGGCTCCCCACATTGTTCAATACATGTCTA
GAGATATGGTTCCAATCCCCAAGGTTCAGGTTCCTGTATCCTATGGAAGT
GGGAGCTTCTCTGAAATGGTTGGCTCCTTTCTCCAATCTCCAAACAGTGA
GCACTCACAGGGAGAAGGAGAAGGAGAAGATTCAGGATCAGCACCTAGTG
GAAATAGAAGAAGAAAGAGAGGCCATGAACATAATAATAACTCTACTTTC
AGTCCAAACAAGAATGCTGAAGATTGTTCTGGGAAGAGAAAAAATCAAGA
TGATGAGAAGAAAGCAAAAGTGGAAGAAAATAAAGACAAAAGTGGTCAAA
GTGGAGAAACACCTAAAGAGAATTTCATTCATGTGAGAGCAAGAAGAGGC
CAAGCTACTAACAGTCACAGCCTTGCAGAAAGGGTAAGGAGAGAAAAGAT
TAGTGAGCGAATGAGGTTGCTTCAAGAACTTGTTCCAGGATGCAACAAGA
TAACTGGCAAAGCAGTGATGCTTGATGAGATTATAAACTATGTGCAATCA
TTGCAACAGCAGGTTGAGTTTTTGTCCATGAAACTTGCCACTGTGAACCC
AGAGCTGAATTTGGACCTAGAGCGGATTCTCTCAAAAGATATTCTGCAAT
CACGAATTGGTGGATATGGTGGTGGTATAAGCTGCTCTCAAGCATTCCCT
AGTTCCAGCTTCCAAGGAACACTAGTGCCCATGCCTACCACTTCAAATCA
ACTCCCTCCCTTGCCTCAGAGTCTGTTGGACCATGAATTCCAAAACTTGT
ATGGAATGAGCTATGATTCTAGTACAGCTCTTGGGAACATGGGGCACAAT
GGAGGATCCAAACCAGAGTTATAGTGTACTGTGTGTAAAAGACATTGGAA
TTGTCCATTTGATTGAAAAATTAACTCAAGTTGGATGAAGGGAGTAATAA
AGGATTCATATTTAGTTAATATGTCAGCGGTATAGGATCTAATAACCTAA
CGGTTCGCCAAGATTAGTTAATCAGATTTGTGAATTATCTATGTATATTT
GAATTGGGTTCACCAAGTGGGGTTCTGAATTGTTTCAACCTAAGCTAGTG
TTCCTTGTTAGAAAAAATGTGGGTACTATTGTAAGGTTATTTGGTTTTCT
AGTTTCCTTTTTTTTTTCTTTTGTGATGAACGAAAGGTTTCTTAGTTCTT
CCTGCGCAGCTTCATGTTATCGAAGTAGGTCCAAGACCAACAAAAATTAC
TTTCATTAAAAGAGTATCATTACACGCGC
back to top
Protein Sequence

aradu.Aradu.4P1MR.1 sequence

>aradu.Aradu.4P1MR.1
MSSDVENAMRLQQEEKKGILMSCPSSLGLGTSGSEMASSNSEPSNVANPF
LASSAWDPLTPLTQLQTTNTTTLVGDPSTSSIPIPIPMVSHHNNEFSNSL
LYTLVLENQQAPHIVQYMSRDMVPIPKVQVPVSYGSGSFSEMVGSFLQSP
NSEHSQGEGEGEDSGSAPSGNRRRKRGHEHNNNSTFSPNKNAEDCSGKRK
NQDDEKKAKVEENKDKSGQSGETPKENFIHVRARRGQATNSHSLAERVRR
EKISERMRLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLAT
VNPELNLDLERILSKDILQSRIGGYGGGISCSQAFPSSSFQGTLVPMPTT
SNQLPPLPQSLLDHEFQNLYGMSYDSSTALGNMGHNGGSKPEL.
back to top