Description
Gene Model Namearadu.Aradu.4PC58
Micro Synteny Viewaradu.Aradu.4PC58
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_Q9MHS6
Descriptionprotein UPSTREAM OF FLC-like isoform X3 [Glycine max]; IPR010369 (Protein of unknown function DUF966)
Protein domainsPF06136 PTHR31083
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.4PC58.1

Sequences
Gene Model Namearadu.Aradu.4PC58
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.4PC58.1 sequence

>aradu.Aradu.4PC58.1
ATGGAAGCAAAAGGTGAAGTGAGAAGGCTTCACATAATTTACTTTCTTAG
TAACATAGGTGGTCGTCCAGATCATCCTCATCTCATTCGTGTTCTTCATC
TTGCTCGTAATGGTGTTTATCTCAGAGACGTTAAGATGTGGCTTGGGGAA
TTGAGAGGAAAAGACTTGCCAGAAGCATTTTCTTGGTCCTACAAGAGGAG
GTACAAAAGCGGGTATGTGTGGCAGGACTTGTTGGATGACGACCTCATAA
CTCCCATTTCTGACAATGAATACGTCCTCAAAGGATCACAAATCCATCCA
ACCCCATTTGAAAATTTTTCCCCTGATGGAAAGACAAAATCTCCGCAAGT
ACATGTTACAGAGGGAAAACAGCAGCCATCTCTAATAGAAGAAGAATCTA
GAATTATTGGACGAGACAGGGAGTCCAAAATGGATACTCCTACGAAAGTA
TCATCGGAGATCAGCCAGGACTCCTTGGTGTTTAGCTCCGAGAGGTCGTC
CGTGACGACGGACGGATACGAATCTTGCAAGGCAGAAGAAGAGAAGGAAA
AGCCTTCGGTGAGAAGCAACAAAGAATGCAGCATTGAAAAAGAACACGAG
AAACCGGAGAATTGTGCATTGCCTTCTTTGTACCACAAACTTCTGAGTAA
GAGTATTGGTAACAAAGAAGAACAGAACAAAACTGATACACCTGATTCTT
CTTTTTCTACCTCCTCCTCTTCGTCGTCACAATCCTCCTTTAGCAAGCTT
AGGAACAGTTCGAACCGAGTTTCGATGGCATTCCGGAACTGGATTTCTTG
TGGGACAGTGGATACAAATGATGCAGCTCTAATAAGGATGGGAGATGCTA
AGAAAATTGATTCAAATGAGTCTATGACTAACTTACCAGAAAATAAAGCA
CAGATTTGTAAAGGAGACAAATTCGGAGGATCAGCCAGGTGTTTTAGAAT
TTCTTGGAATAATGATCAACAAGAAAACCAACATGGGGCCAGAAAAAGTT
TTGATGGGGAGGAAACAAACAGAAGCAGGAGAAAGCTGGGTGACTTCTTA
AATCAAACTCATCACAAACCACTTGGTGAACCAATTTGCTCGCTATGTGG
GAAGCCGTTCAAACCAGAGAAAATGTACAAACACATGAAGTCTTGTAAAG
GAATCAAAGCATTGGGAACATCCACTGCAACAGCAGCACTTGCTGACAAG
ACACAGCTTCATAGATCATCAACTTCCAATCATACAAATTACCTTTTGAC
TAATTAGAAAGATGAAAATCCCTTTCACCCTCTAGAACCAACTTAGCATT
TGGCTTTTATGTTTAGATGTAGCTCATCCTATTAGATATTCTTGTCTTTC
TCTGCTAGTTCAAGTCAACGCCTGCTTCGAATGTGAGGCCTACTTGGGTC
TATACCATCTTTATATAGCAAAGAGG
back to top
Protein Sequence

aradu.Aradu.4PC58.1 sequence

>aradu.Aradu.4PC58.1
MEAKGEVRRLHIIYFLSNIGGRPDHPHLIRVLHLARNGVYLRDVKMWLGE
LRGKDLPEAFSWSYKRRYKSGYVWQDLLDDDLITPISDNEYVLKGSQIHP
TPFENFSPDGKTKSPQVHVTEGKQQPSLIEEESRIIGRDRESKMDTPTKV
SSEISQDSLVFSSERSSVTTDGYESCKAEEEKEKPSVRSNKECSIEKEHE
KPENCALPSLYHKLLSKSIGNKEEQNKTDTPDSSFSTSSSSSSQSSFSKL
RNSSNRVSMAFRNWISCGTVDTNDAALIRMGDAKKIDSNESMTNLPENKA
QICKGDKFGGSARCFRISWNNDQQENQHGARKSFDGEETNRSRRKLGDFL
NQTHHKPLGEPICSLCGKPFKPEKMYKHMKSCKGIKALGTSTATAALADK
TQLHRSSTSNHTNYLLTN.
back to top
Expression

Gene expression for aradu.Aradu.4PC58 has been determined by its associated transcript, Adur49185_comp0_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.