Description
Gene Model Namearadu.Aradu.4RJ0E
Micro Synteny Viewaradu.Aradu.4RJ0E
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_0J2XWB
DescriptionNAC domain containing protein 47; IPR003441 (NAC domain); GO:0003677 (DNA binding)
Protein domainsPF02365 PTHR31719 PTHR31719:SF0 SSF101941
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.4RJ0E.1

Sequences
Gene Model Namearadu.Aradu.4RJ0E
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.4RJ0E.1 sequence

>aradu.Aradu.4RJ0E.1
CTTCTTCTCATTCATTCATGCCCCCTTCCCCTCTTGGCCTAATCTCTTTC
TCCACATGGCGACAAATTCCGTCAACCATAAAATCCCCCTCACTTCTCAC
CTCCCCAAAAATTTCAATCCTCTCTTCTTCCCTTTTCCTACACTTTAGTT
TGCTACACCAAACTTCTCTCTCCCTTCTCTTATTCTTATTATTCCTCACC
AAGCCTATTAACAAATATTTTCTTACACCAAATTATTAGCCTCTCAAAAA
TGGGATCACCCGAATCAAATTTGCCACCAGGTTTTAGGTTCCATCCAACG
GATGAAGAACTCATTCTTCACTACCTTAGGAAGAAGGTAGCATCCATACC
CTTACCTGTTTCCATCATCGCTGAGGTTGATATCTACAAATTGGATCCAT
GGGAATTACCAGCTAAGGCTGCGTTTGGTGAGAAAGAATGGTACTTCTTC
AGTCCAAGAGACCGGAAGTACCCAAACGGTGCGAGGCCAAACAGGGCAGC
TGCTTCAGGGTATTGGAAGGCTACGGGTACCGACAAGACCATCGTGGTGT
CGCCGGCGGCCACAGTTACACGTAGAGTAGGCCAAGAGAGCAGCGTTGGT
GTCAAGAAGGCTCTTGTTTTCTACAAAGGAAGGCCTCCAAAGGGTGTCAA
AACCAATTGGATCATGCACGAATATCGTCTTGTAGACAACAACAGACCCA
TTAAGCTCAAAGATACCTCCATGAGATTGGATGACTGGGTTCTATGCCGG
ATTTATAAGAAGTCGAAATTCTCAGTATCTTCACCGGAGGAATCACCGTC
GAGTGAAGTACAGGCTGCAGAAGAAAATGGTTTATTCAAGAACACCATTT
TAAGGAGTCCAATTCCAACACCGTCGCCATCGCCACCGCCGCCGCTGCCG
CAGCCACTGCTCTCTCAAAAATCTGTGTCCTTCTCAAACCTCTTAGATGC
CATGGACTACTCCATGCTCAGCACCATCTTATCGGAGAACAATAACAACA
GCACCCTTGATCAGCAACAATACTCGCAGATCAACACCAACCAATTGAAC
CATTCATCGAACATGGAGAACACTAGTAACAGCAACATGATGGTGATGAG
GTCAAAGCGCCAGATAGAGGAGGAAACAACAACGGTGTTGCACCCATCAA
AGAAGTTCCATCACCAACTTATGGGCTCTTCTTCTTGCAGCTTCCCTAAT
AACATTAACAACACAAACACTGCACAATACGAGAACCCGCAATGGAACTA
CCTTGTCAAGCAATCCTTCTTGAACCAGCACTTACTTCTCGCTCCTCATC
TTCGATTTCAAGGATAG
back to top
Protein Sequence

aradu.Aradu.4RJ0E.1 sequence

>aradu.Aradu.4RJ0E.1
MGSPESNLPPGFRFHPTDEELILHYLRKKVASIPLPVSIIAEVDIYKLDP
WELPAKAAFGEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKTIVV
SPAATVTRRVGQESSVGVKKALVFYKGRPPKGVKTNWIMHEYRLVDNNRP
IKLKDTSMRLDDWVLCRIYKKSKFSVSSPEESPSSEVQAAEENGLFKNTI
LRSPIPTPSPSPPPPLPQPLLSQKSVSFSNLLDAMDYSMLSTILSENNNN
STLDQQQYSQINTNQLNHSSNMENTSNSNMMVMRSKRQIEEETTTVLHPS
KKFHHQLMGSSSCSFPNNINNTNTAQYENPQWNYLVKQSFLNQHLLLAPH
LRFQG.
back to top