Description
Gene Model Namearadu.Aradu.632MM
Micro Synteny Viewaradu.Aradu.632MM
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_0MFX8H
Descriptiondihydroflavonol 4-reductase; IPR001509 (NAD-dependent epimerase/dehydratase), IPR016040 (NAD(P)-binding domain); GO:0003824 (catalytic activity), GO:0044237 (cellular metabolic process), GO:0050662 (coenzyme binding)
Protein domainsG3DSA:3.40.50.720 PF01370 PTHR10366 PTHR10366:SF9 SSF51735
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.632MM.1

Sequences
Gene Model Namearadu.Aradu.632MM
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.632MM.1 sequence

>aradu.Aradu.632MM.1
AATAAGAAACAAATATTAGTTTATAGAAAAGTTGAATAAGTAAATTTTAA
GAATTCAATTTTGTATGTACTATGCATATATACAAGAAGAAGCAGGTTTC
TCATTTCAGAGTCCATCATCAAGCGAATTGAAACTATCATATTTAGAAGC
ATATCGTAGTAGAGAATAGAAGAAAGGAGTTCTTTGTATCAATGGAAGGT
GGGAAGGGAAGGGTGTGTGTTACAGGAGGTACGGGATTCATTGCTTCAGT
TATCATCAAGAGACTCCTTCATGAAGGTTACTCTGTTAATACTACCGTTA
GATCAAGTCCAGCTAATAGCAAGAAAGATGTTACCTTCCTCACAAATCTA
CCTGGTGCACCTCAAAGGCTACAAATTTTCAATGCTGACCTCAACAATCC
AGAGAGTTTCAATGCAGCAATTGAAGGATGCATTGGGGTGTTCCACACAG
CAACCCCCAGCCCAACAACTGATAATAATTATTCTTCCCAATCAAACCAA
ACCCAAGAATCAATAATCAAAACAAATGTTGATGGTGTCTTGGGAATCCT
AAAATCATGTTTGAATTCTAAGACTGTTAAAAGAGTTGTTTATACCTCAA
GTGGCTCTGCTGTGATCCATAATAACCGCACAAGGGAGCATGAAATAATG
GATGAGAGTTATTGGAGTGATGTTGATTTTCTTCGTGACACAAAGCCATT
TCTATGGTTTAACAGTGTTTCAAAGACACTGGCAGAGAAGGCAGCACTTG
AATTCGGAGAACAACATGGGTTAGAAGTTGTGTCTTTGATCCCTCCTTTG
GTTCTTGGACCCTTCATTTGTTCTAAACTCCCTGATTCTGTTCACATCTC
TCTGGCTCTTTTATTTGGCCGTGATAACCTGGATCAACTTGGTGCTCTTC
TTCGTTTCCCTATAGCACATGTAGATGACTTGGCAAGGGCACACATTTTT
CTGCTTCAACATCAAAATCCAAAAGGGAGATACAATTGCTCACCATGCAG
TGTAACTCTAGAAGAGATAGCTGAAATTATTCGTTCAAAGCACCCTGAAT
TTAAAATACCTTCACCAGAGTCGATAAAGAAAATTAAGGGTGAGAATGTA
CCACATTTGAACTCAAAGAAATTAATTGACGCTGGATTTGAGTTCAAGTA
TGGGACAGAGGAAACATTTGAGGAAGCCATTCAGTGCTGCAAGGAAAAGG
GTTATCTTAACTCTTGAGTACTACGGAATTAATTAAAAAATAATAATTAA
GGGTGTGGCTTGTAAGATTATTATTAGTTGATTGAAGAAAAACAAGTGAA
ACTAAATTCCAATACCAGGAAGAAATTAAATAAATTGTCTCTAATGTCTT
CTTATTCTATGACAATAA
back to top
Protein Sequence

aradu.Aradu.632MM.1 sequence

>aradu.Aradu.632MM.1
MEGGKGRVCVTGGTGFIASVIIKRLLHEGYSVNTTVRSSPANSKKDVTFL
TNLPGAPQRLQIFNADLNNPESFNAAIEGCIGVFHTATPSPTTDNNYSSQ
SNQTQESIIKTNVDGVLGILKSCLNSKTVKRVVYTSSGSAVIHNNRTREH
EIMDESYWSDVDFLRDTKPFLWFNSVSKTLAEKAALEFGEQHGLEVVSLI
PPLVLGPFICSKLPDSVHISLALLFGRDNLDQLGALLRFPIAHVDDLARA
HIFLLQHQNPKGRYNCSPCSVTLEEIAEIIRSKHPEFKIPSPESIKKIKG
ENVPHLNSKKLIDAGFEFKYGTEETFEEAIQCCKEKGYLNS.
back to top
Expression

Gene expression for aradu.Aradu.632MM has been determined by its associated transcript, Adur47077_comp0_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.