Description
Gene Model Namearadu.Aradu.66DGF
Micro Synteny Viewaradu.Aradu.66DGF
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_Y233XT
DescriptionMADS-box transcription factor 6 [Glycine max]; IPR002100 (Transcription factor, MADS-box), IPR002487 (Transcription factor, K-box); GO:0003677 (DNA binding), GO:0003700 (sequence-specific DNA binding transcription factor activity), GO:0005634 (nucleus), GO:0046983 (protein dimerization activity)
Protein domainsCoil PF00319 PF01486 PR00404 PTHR11945 PTHR11945:SF50 SM00432 SSF55455
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.66DGF.1

Sequences
Gene Model Namearadu.Aradu.66DGF
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.66DGF.1 sequence

>aradu.Aradu.66DGF.1
ATGACCAAAATGTCAAAACAGAAGATGGAGATAAAGAAGATAGAGAAGAA
TGCATCAAGGCAAGCCACCTTTAGTAAGAGGAAGAGAGGGATTTTCAAGA
AGGCTAAGGAGCTTTCAACTCTTTGTGATGCTGACTTGGCTCTCATTGTC
TTTTCTCCTTCTGGCAAGCTCTTCGATTTCGCTTCCTCAAGTGTGCAGGA
AGTAACTGAAAGATATCATATGCAAACAAGCATTTACAGATCACAAGACC
AACAGTCTCATGAGTTTCAACTTGAGAAGGACACCTACTACCTGAAGTGC
AAGGAACTCACAGATAAGACTATTGGACTCAGGCACTTGAATGGAGAGGA
GCTGCAAGGATTGAAAATTCATGAACTACAAAAACTAGAGAGAGTGTTAG
AAAAGGGTTTGGCTCGTGTTTCAAAAGAAAAGGATCAAAGAAATCTTAAA
GATATTATTGAGATGAAGAAAAGGGGACTTCAAATGGTGCAAGACAACCA
TCGACTGAAAAAGATGAGAAGTCAAGCAAACAGCCAAGGGCAATCATCAA
AGTCAAACTCTGTTGAAGAGTCAGATAACCGTGATCATGATGCTCCTAAT
CTCAACTTGGGGCTTCCAATGTTCGAATGAAATGAAACCGTAAAAAGTTA
ATTTGGGAGAAGCGCAGTTGTGTTCTCTTTCATTATTAGCTCAAATAATA
TCCTTATTAGTAGTAAGTAGTAGTATCTATAATTGTAAGTATATAATAAT
GGTGAATGATGATAGATACATATGGTTCTTATATTATCGATGATCACCAA
AGATACTGTTACCTAGCATAACAGGTTAATAATAAATTAATAACCATCTG
ACATGAGATGTCGACGCCAAAACAATACAATCTAATATTATTTAGATTCC
TGTATTTATAAGCTTCTGTAATAATTGATATTTTGCGTAATAAA
back to top
Protein Sequence

aradu.Aradu.66DGF.1 sequence

>aradu.Aradu.66DGF.1
MTKMSKQKMEIKKIEKNASRQATFSKRKRGIFKKAKELSTLCDADLALIV
FSPSGKLFDFASSSVQEVTERYHMQTSIYRSQDQQSHEFQLEKDTYYLKC
KELTDKTIGLRHLNGEELQGLKIHELQKLERVLEKGLARVSKEKDQRNLK
DIIEMKKRGLQMVQDNHRLKKMRSQANSQGQSSKSNSVEESDNRDHDAPN
LNLGLPMFE.
back to top