Description
Gene Model Namearadu.Aradu.6TN9T
Micro Synteny Viewaradu.Aradu.6TN9T
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_15FC42
DescriptionLOB domain-containing protein 4; IPR004883 (Lateral organ boundaries, LOB)
Protein domainsCoil PF03195 PTHR31301
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.6TN9T.1

Sequences
Gene Model Namearadu.Aradu.6TN9T
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.6TN9T.1 sequence

>aradu.Aradu.6TN9T.1
AATCATGCTCCGTATGTTGCTTTTAGTAACTAGTCCCTTCTAATCATCAC
TACCTTTTTGTCTTTTTTTTAGTTAGTATTTTCTGATCATAAGAAAATAG
AAATGGGAAGTGGAAACTCGCCATGTGCTTCATGCAAGCTTCTTAGACGG
AGGTGTGCCAAGGATTGCATCTTCGCACCTTATTTCCCTTCCGATGACCC
TCAAAAGTTCGCCATTGTTCACAAGGTCTTTGGTGCTAGCAACGTTAGCA
AAATGTTACAGGAGCTTCCGATTCATCAAAGAGCAGATGCAGTGAGTAGC
TTGGTATACGAAGCGAACGCAAGGGTTCGTGACCCGGTGTATGGATGCGT
GGGAGCCATATCATACCTTCAGAACCAAGTCTCAGAGCTTCAAATGCAGC
TTGCTGTTGCGCAGGCAGAGATACTCTGCATCCAGATGCAGCATGAACCC
TCTGTAGCCGCAGCAATACCCAATCCACAACAAATAATGGAGTTTCAAGA
ACAGAACAATAATAATAATGAACTCACTCACCATCACCATCACCATCATC
AGTACCTTAACTTTGCAGCAGCTTCTTCTAGCAATGTAATCCATGATTCT
CTCTCTAGAGAGACTTTCTTTGGACATGACATGGTTTCTTAATTCAGTAA
TGAAATTTCCTAACTTAATTGCTAATTGCTTTTTGGTCCTTTTCATCTAT
TATAACTTGTCATACAGAAATTCTTGAATGTGGACTAAAAAAAAATTAAC
AGAGTTATAGTGTATCCGGTTT
back to top
Protein Sequence

aradu.Aradu.6TN9T.1 sequence

>aradu.Aradu.6TN9T.1
MGSGNSPCASCKLLRRRCAKDCIFAPYFPSDDPQKFAIVHKVFGASNVSK
MLQELPIHQRADAVSSLVYEANARVRDPVYGCVGAISYLQNQVSELQMQL
AVAQAEILCIQMQHEPSVAAAIPNPQQIMEFQEQNNNNNELTHHHHHHHQ
YLNFAAASSSNVIHDSLSRETFFGHDMVS.
back to top
Expression

Gene expression for aradu.Aradu.6TN9T has been determined by its associated transcript, Adur42619_comp0_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.