Description
Gene Model Namearadu.Aradu.82M1H
Micro Synteny Viewaradu.Aradu.82M1H
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Family not assigned to a gene family
DescriptionProtein kinase superfamily protein; IPR011009 (Protein kinase-like domain); GO:0004672 (protein kinase activity), GO:0006468 (protein phosphorylation)
Protein domainsG3DSA:1.10.510.10 PF07714 PTHR24420 PTHR24420:SF524 SSF56112
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.82M1H.1

Sequences
Gene Model Namearadu.Aradu.82M1H
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.82M1H.1 sequence

>aradu.Aradu.82M1H.1
CTTAGTTTGTATTTTTCTGTGCTTCTTCTTGGGTATGATGCAAGATAGAA
TTATTAAATATTTCCTTTGTACGGTGAAAGCTCTTTAGCGGAAAAATTTG
CCTTTTCGTTTCTTTTTTTAGTTTTTACCTACTTTCTTTCCGCCTTCCTT
ACCATCACACATTTTGCCTACTTTTGTTTTATTCCACAACATTTTTTATT
ATTATTCAGACTTAAACAAGATTTTATGTTAGTTCTTTTCTGTTGAAACA
CCCATTTTTCTATAAAACATGTTTTTATGCTTAAACACTAACCCACTAAA
ATCAGTTCTTTACTATTTTTTCTTGTATTTTAGTGAAAACAAGTTGTTCA
TCATTAAAAAAAAACATGGAAAAGTTGAAGATGCTGTGGTCTTGGTCCTT
TCTATTCTCACTTATATTAAGAACCTCCACCTCACTTGACAATATAACCG
TTTTTCAATCCCTCAGCGATGGAGAGACATTGATTTCACATGAAGGAATC
TTTGAACTTGGTTTCTTCAGTCCTGGAAACTCAAAGGGCCGATACGTAGG
TATCTGGTACCATAATATGTCCCCTTTAACAGTTGTGTGGGTTGCCAACA
GAGAAACTGCACTCAATGATACCTCTGGAGTTTTAAAAGTAACCCATCAA
GGACTTGTTCTCCTTGTTAATGGCACCAGCAACAGCACTGTGTGGTCTTC
CACCATGTCAATCAAAGCGGAGAATCCGGTTGCACAGCTCCTGGTCTCAG
GAAATCTTGTTGTCAAAGATGGCCATAATGAGGAGAACTTCTTGTGGCAG
AGTTTTGATTTTCTTGGCGATACTTTCTTACCAGGATCAAAGATAGGTTG
GGATCCAGTGACAGGGATAGAGAGAACCTTAACATCTTCGAAAAGTGCTG
ATGATCCCGGCCATGGAGACTTCAAATTCAGAATAGACCCCAGAGGCTAT
CCACAAGCTGTTCTAACGAACGGAACGGTTATAATGGTCAGAGTAGGACC
CTGGAATGGACTTATGTTTTCAGGAGCTACCATTTATTTGCGCTATAGTA
AATTACTGCCAACTGATTATGATTTCATTGATAAGGAGCTAATTTGTAAA
CTCCAACCTTTACATGCATATAGTGTTATTAGAAGTGTGGTGACCCCTTG
GGGTGGTGTGCAGCTTCTGCATTGGTCAAGACAAACCAGTAGCTGGGAGA
CATTTCTTTCTTTACCAGAAGGTGAATGTGACAAGTATGCGCACTGTGGC
GCAAATTCTGTTTGTAGAGTCACTCCGGCTCCAATCTGCACATGCCTAGA
AGGATTTGTTCCAAAATACTCAAGAAAGTGGAAGGACATGTATTGGTCTG
ATGGTTGTGTTAGGATCACTCCATTAAGTTGCAGCAAAGATGGTTTCAAG
AAGCACTCAGGTGTGGTGTTGCCTGACACATCTACCTCTTGGCATAACAT
GACCATGAACCTGCAGGAATGTGAGGCCTTGTGTAGGAAAAATTGTTCCT
GTACGGCATATTCCAATTTGGATGTCCGTGGCGGAGGAAGTGGTTGCATA
CTTTGGTTTCATGATTTGATTGATATGAGACAAGGAGGACAAGATCTTTA
TATTCGACTACCTATGTCAGAGCTAGGTGATGAGTCAAACAAGAAAAAGC
TTGTAGGCATGATTGTTGGCTCCATTTTGTTCTTTATGAGCATGATGTTT
GGACTGGTTCTATGTCTATGGAGAAAGAAACTTGAGGAACCAGGTGAGTT
CATGATATTAACATGTGACTACTTCTATTTTGCAGTGATATTTGGAAGAA
CTATAATTTTGCAGTCCCATTAGTCTTGAAATCTTTTGCTTGAAGAATTT
TTATTCTTTTTTTCAAAGTTAACAAATCAACATGAATTTCTTGACATTCT
CAGAAATATTTTGGTGGAAGCAACGGGCTCACGAAAGGGAAAAGGATGAC
ATGGATCTTCCAATGTTTGATTTATCAACCATAGTTTATGCCACTAATTA
CTTCTCTAGTGACAACAAATTGGGAGAAGGTGGATTTGGATCTGTATACA
AGGGTGCACTTGAAAATGGGACAGAGATTGCTGTGAAGAGGCTTTCCATT
GACTCTGAACAAGGACTGGATGAGTTTAAAAATGAAGTTCAGTTAATTGC
AAAACTTCAGCATCGCAACCTTGTAAAGCTTCTTGGCTGTTGCATTCAAC
GAAAAGAAAAACTCTTGATTTATGAGCTCGTGCCCAATAGGAGTTTGGAC
ACCTTTATTTTTGATGATTCTAGAAGAAAATTATTAGATTGGGCAAAGCG
CTTTCAAATTATTGGCGGAACAGCTCGAGGCCTAGTTTATTTACATCAAG
ATTCTAGGCTAAGAGTGATTCATAGAGATCTAAAAACTAGCAATATACTT
CTTGATAAAGACATGAACGCGAAAATATCAGACTTTGGTCTTGCTAGGAC
ATTTGCCGGAGATCAAACTGAGGCCAGAACAAAAAGAGTGATGGGAACTT
AGTTAGTAGGCTAAATATTGTTTACTGTTTCAAGCTGTAACATATTCCTT
TCGCGATTCTCATGTGATGTACTAAATGCAATGCAGTGGTTATATTTCTC
CAGAGTATGCGGTGCGTGGATCCTTCTCAATGAAATCTGATGTGTTCGCT
TTTGGTGTAATTGTGCTTGAGATAGTAAGTGGCAAGAAGAACAGAGAGTT
TTGTGTCCCTCACCAGAGTCTTAACCTTCTTGGACATGCATGGGAGCTCT
GGAATGAGGAGAGGCCCTTGGAACTGGTAGATGAATCAGTGCGCAATTCG
GTGATTGAAGTTGAAGCATTGAGATGCATACACATAGGGCTGTTATGTGT
TCAAGGGAGACCAGAAGATAGGCCTAACATGTCATCTGTAGTTCGTATGC
TGGAAGATGATAAACCATTGCCCAAGCCGAGGCTTCCGGCATTTTACTCA
CACCAGGAAGAATCTATGGGAAGAGATGATGGAGTTTCAGCAAATGAGGT
TACCATATCATTGTTAGGAGCAAGATAGCTAAGAGTTATACACAGAGATC
TAAAAGCTAGCAATATCCTTCTTGACAAAGACATGAACGCGAAAATATCA
GACTTTGGTCTTGCTAGGACATTTGCCGGAGATCAATCTGAGGCCACAAC
AAAAAGAGTGATGGGAACATATGGCTATATTTCTCCTGAGTATGCAGTGC
ACGGATCCTTCTCAACGAAATCTGATGTGTTCGCCTTTGGCGTCATTGTG
CTTGAGATAGTCAGTGGGAAGAAGAACAGAGAGTTTTGCGTCCCTCACCA
ACGTCTCTACCTTCTTGGACATGCATGGGAGCTCTGGAATGAGGAGAGGC
CTTTGGAGCTAGTGGATGAATCAGTGCGCGATTCGGTCATTGAAGTTGAA
GCATTAAGATGCATACAGATAGGGCTTTTATGTGTTCAAGGGAGACCAGA
AGATAGGCCTAACATGTCATCTGTAGTTCGTATGCTGGAAGATGATAAAC
CGTTGCCTGAGCCGAGGCTGCCGGCTTTTACTCGCACCATGAAGAATCTT
TGGGAAGAGATGATGAAGTTTCAGCAAATGAGGTTACCGTTTCATCGTTA
G
back to top
Protein Sequence

aradu.Aradu.82M1H.1 sequence

>aradu.Aradu.82M1H.1
MNAKISDFGLARTFAGDQSEATTKRVMGTYGYISPEYAVHGSFSTKSDVF
AFGVIVLEIVSGKKNREFCVPHQRLYLLGHAWELWNEERPLELVDESVRD
SVIEVEALRCIQIGLLCVQGRPEDRPNMSSVVRMLEDDKPLPEPRLPAFT
RTMKNLWEEMMKFQQMRLPFHR.
back to top
Expression

Gene expression for aradu.Aradu.82M1H has been determined by its associated transcript, Adur37813_comp2_c0_seq3 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.