Description
Gene Model Namearadu.Aradu.8E61R
Micro Synteny Viewaradu.Aradu.8E61R
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_3Y9YXY
DescriptionClass II aminoacyl-tRNA and biotin synthetases superfamily protein; IPR018150 (Aminoacyl-tRNA synthetase, class II (D/K/N)-like); GO:0000166 (nucleotide binding), GO:0004812 (aminoacyl-tRNA ligase activity), GO:0004815 (aspartate-tRNA ligase activity), GO:0005524 (ATP binding), GO:0005737 (cytoplasm), GO:0006418 (tRNA aminoacylation for protein translation), GO:0006422 (aspartyl-tRNA aminoacylation)
Protein domainsG3DSA:3.30.930.10 PF00152 PR01042 PTHR22594 PTHR22594:SF10 SSF55681
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.8E61R.1

Sequences
Gene Model Namearadu.Aradu.8E61R
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.8E61R.1 sequence

>aradu.Aradu.8E61R.1
ATGATAGAGATGGTGGAGGTTCAAGTGAGGAAGTTGTATTGTGTTAGCAG
GGCCCTTCCAACTCTACCAATTAATCTCGAGGATGCTGCTCGAAGTGAAG
CTGAAATTGAGAAGACACTTCAGGCTGGTGAACAACTTGTTCGTGTAAAT
CAGGATACACGTTTGAACTTTAGAGTACTTGACCTCAGAACCCCGGCTAA
TCAAGGAATTTTTTGCATTCAACCACAAGATGGAAATTTGATTGCTGGGT
CAAGCGAGGGTGGAGCTGCTGTTTTCAGACTGGGCTATAAAGGGCACCCT
GCTTGCCTTATCCAATCACCACAGCTTCACAGGCAAATGGCAATATGTGC
TGATTTTGGCCGTGTTTTTGAGATTATTCCTGCGTTTAGGGCTGAGGATT
CCTTCACACACAGACATATGTGTGAGTTTACTGGTCTTGATGTTGAAATG
CAGATTAAGAAGCATTATTATGAGATTATGGATAAAGTTGATAGGTTGTT
TGTCTCAATATTTGATAGCTTGAACCAGAATTGTAAGAAGGCTCTTGATG
CTTATCTTCGTCAGACTCTGCGGCTTACATATGAAGAAGGGGTTCAGATG
CTCAAGGATGCTGGAGTAGAGATTGAACCTTTTGATGACTTGAACACTGA
AGCTGAAAGTAAGTTGGGGCAGCTAGTTTTAGAGAAGTATGACACGGAGT
TCTATATCCTTTACTGGTACCCCTTGGCTGTAAGGCCATTTTACACAAGG
TCTTGCTATGATGAGGAGATCATTTCAGGAGTTCAGTGTGTCCACAATGC
AGAAATGTTGAAAAACAGCTGAGTCTTGCAGCATTGATGTCAAGACGATA
TCTACATACATTGATTATTTCAGGCATTCTTCATGGCCTTTTACTCAGTT
CATCTTGCCATATAATTCTTTGTTTCTTTGTGTAACTCTAGCAGCTATTG
TCTCCATACATCGGTAAATATCATTTTAATAAAATTGT
back to top
Protein Sequence

aradu.Aradu.8E61R.1 sequence

>aradu.Aradu.8E61R.1
MIEMVEVQVRKLYCVSRALPTLPINLEDAARSEAEIEKTLQAGEQLVRVN
QDTRLNFRVLDLRTPANQGIFCIQPQDGNLIAGSSEGGAAVFRLGYKGHP
ACLIQSPQLHRQMAICADFGRVFEIIPAFRAEDSFTHRHMCEFTGLDVEM
QIKKHYYEIMDKVDRLFVSIFDSLNQNCKKALDAYLRQTLRLTYEEGVQM
LKDAGVEIEPFDDLNTEAESKLGQLVLEKYDTEFYILYWYPLAVRPFYTR
SCYDEEIISGVQCVHNAEMLKNS.
back to top