Description
Gene Model Namearadu.Aradu.8MU6L
Micro Synteny Viewaradu.Aradu.8MU6L
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_8Y4ZSH
DescriptionRING-H2 finger protein ATL66-like [Glycine max]; IPR013083 (Zinc finger, RING/FYVE/PHD-type)
Protein domainsG3DSA:3.30.40.10
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.8MU6L.1

Sequences
Gene Model Namearadu.Aradu.8MU6L
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.8MU6L.1 sequence

>aradu.Aradu.8MU6L.1
ATGTCGGCGCCCAACCACGACTATCACAAATTCGACTGGCACTTCAACAC
GGAGCTCGAGGACGAGACCATCGAACTCCGAGGCCGGAGGCTCATCTTTG
TTATCGTCCTCTTCGTCATTATCCTCATCACCACCGCCTTCTTCGTCTAC
CTCCGCTGGATCTGCCGCTCCCGCGGCCTCATCCCGGTCACATCGATCCA
CCTCCGCCACCAGTTGCCGCCGCACACTCAACCTCAGTCCAACGGCCTGG
ACGCGGCCACCATCAAGAAACTCCCGATCGTGCTCTACCAGGCGCCGCCA
ACTGCGTCTGCGACAGATCTGAACCGCGGCGGTGCGTTGGAATGCTGCAT
ATGCCTGAGCGCGTTCCGCGACGGAGAGAAGCTGAAGACTCTTCCCGAGT
ATTACTTGTTCGTGCACGGCTGCACGATTTCTAAATACCTAAAAGAGCAC
CGTGTTAAAGGCGCCTTGGATCTTGCGCACCAGGAGAAATTTGATGACAC
GCCCGCCGGAGCAGATTAG
back to top
Protein Sequence

aradu.Aradu.8MU6L.1 sequence

>aradu.Aradu.8MU6L.1
MSAPNHDYHKFDWHFNTELEDETIELRGRRLIFVIVLFVIILITTAFFVY
LRWICRSRGLIPVTSIHLRHQLPPHTQPQSNGLDAATIKKLPIVLYQAPP
TASATDLNRGGALECCICLSAFRDGEKLKTLPEYYLFVHGCTISKYLKEH
RVKGALDLAHQEKFDDTPAGAD.
back to top