Description
Gene Model Namearadu.Aradu.A8TMM
Micro Synteny Viewaradu.Aradu.A8TMM
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_9GHCLY
Descriptionprotein ROOT PRIMORDIUM DEFECTIVE 1-like isoform 1 [Glycine max]; IPR021099 (Plant organelle RNA recognition domain)
Protein domainsPF11955 PTHR31476 PTHR31476:SF0
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.A8TMM.1

Sequences
Gene Model Namearadu.Aradu.A8TMM
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.A8TMM.1 sequence

>aradu.Aradu.A8TMM.1
ATGAAGAAGGATCCAAACCTCAAATTTGCATTCTCCCATAACTGCCGCTG
GATTGTCAACAACCAGATAAAGAACATCATCCTCTACTATCCAAACCCCC
ATTCCATCTGTTCAAAAGAAGCAAAACCCTCAATCAGCTCCACAAGTACT
CTGCCTGCTTCGATGTTACTTTCACCGGTGATGAATACTGTTGTAACCTC
TAAGCGCATGATGAGTCTTGTCAAAGAGGAGGAATTTGTTAGGGAGTTAG
CAAAATTACTTATGATGAGTGTCAACAAGAGGATTAATGTTCTGAACCTC
AATGAGCTGAAAAGGAATTCAGGGTTTCTCGATGATTACATGATTAGGAT
TGTTGCAAAGTACCCGAATTTGTTTTGTGTTGTTAACGAGGGCAGGAGGA
AGAGCTCCATGGAGATTGAATTGGTTCACTGGAACTCTGAATTTGCTATA
TCCACAGTGGAGACTACGGCCAGGAGGAGTGGCAATACAAGGCTAACGTT
CTCGTGTTCTTTGCCTTTCAGTGGAGAGAGATTCCGTGTATTCGATTTGG
TTCCTTACTTTTCGCCTTGCATGGACTCCAGGAAATTGGTGGAAGGGACG
AAAGAGATGGAGAAGAGGAATGTGGGATTGGCACATAAGATGTTGTCTTT
GACTCTTTGGAAGAAAGCCTCAATAGTGAAGTTAAGTCATTTTAGGAGGG
TGTTCGCTTTGTCTGATAGGTTGAATGTGTTGTTGCTCAAGCACCATGGG
ATTTTCTGTTTCCAACAAGGAGGCGTCTGTCAGGTTGAACTTGTTGAAAA
GAATCCTCTAGTTGTTGTGAAGGAGAAATATGGACAACTGATGCAGGGGG
CTTCATGA
back to top
Protein Sequence

aradu.Aradu.A8TMM.1 sequence

>aradu.Aradu.A8TMM.1
MKKDPNLKFAFSHNCRWIVNNQIKNIILYYPNPHSICSKEAKPSISSTST
LPASMLLSPVMNTVVTSKRMMSLVKEEEFVRELAKLLMMSVNKRINVLNL
NELKRNSGFLDDYMIRIVAKYPNLFCVVNEGRRKSSMEIELVHWNSEFAI
STVETTARRSGNTRLTFSCSLPFSGERFRVFDLVPYFSPCMDSRKLVEGT
KEMEKRNVGLAHKMLSLTLWKKASIVKLSHFRRVFALSDRLNVLLLKHHG
IFCFQQGGVCQVELVEKNPLVVVKEKYGQLMQGAS.
back to top
Expression

Gene expression for aradu.Aradu.A8TMM has been determined by its associated transcript, Adur25235_comp0_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.