Description
Gene Model Namearadu.Aradu.B17TN
Micro Synteny Viewaradu.Aradu.B17TN
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_0F94Z3
Descriptionreceptor-like serine/threonine kinase 2; IPR000858 (S-locus glycoprotein), IPR001480 (Bulb-type lectin domain), IPR003609 (Apple-like), IPR011009 (Protein kinase-like domain), IPR013320 (Concanavalin A-like lectin/glucanase, subgroup), IPR021820 (S-locus receptor kinase, C-terminal), IPR022126 (S-locus, receptor kinase), IPR024171 (S-receptor-like serine/threonine-protein kinase); GO:0004672 (protein kinase activity), GO:0004674 (protein serine/threonine kinase activity), GO:0005524 (ATP binding), GO:0006468 (protein phosphorylation), GO:0048544 (recognition of pollen)
Protein domainsG3DSA:1.10.510.10 G3DSA:2.60.120.200 G3DSA:2.90.10.10 G3DSA:3.30.200.20 PF00954 PF01453 PF07714 PF08276 PF11883 PF12398 PIRSF000641 PTHR24420 PTHR24420:SF524 SM00108 SM00220 SM00473 SSF51110 SSF56112
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.B17TN.1

Sequences
Gene Model Namearadu.Aradu.B17TN
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.B17TN.1 sequence

>aradu.Aradu.B17TN.1
AATCTACCAGGAAATTGTCATAACCCTAAATGAAGAAGCCAAAAACGCTT
CATATACTCTCTCAACATTCACACACAACTCTCTCACCTTTCCACAAACA
TGCCAACCTCATTCACTAGTTTCCTTAACCACCTCCTCATTTCCTTCTTC
CTCTTCTTCCTCACTTCATCAAACTNNNNACACAAATTCTTACTACTAAC
CAAACCCTCTTATCACAGAACCAAACCTTTGTTCTCGGCTTCTTCGGAGG
TTCCAACACCAACTATTACCTCGGAATATGGTACAACAACATCAATCCTC
AAACAATAGTTTGGGTTGCAAACAGAGACAACCCCATTGACAATTCCACA
GGCTATCTCAAGATCGGAGACAACGGAAACTTTGTCCTTCTCAATTCATC
CGGTAACCCGGCATGGTCCTCCAACCAAACCAACGCCAAGAATCCAGTTA
TCCAGCTCCTGGAAACCGGTAACCTTGTTCTCAAAGATTCAGAACAGAGC
AACAACTACCTATGGCAGAGCTTCGATTACCCAACAGATACCTTGCTACC
GGGGATGCAGATGGGTTGGAACTTCGACACAGGAATTGAGAAGCACTTAA
CATCGTGGAAGGTCACAGGTGAAGACCCTTCTTCCGGTGACTACACTTTC
AAGCTAGATTACCGCGGTTTACCTGAGATTTTTCTGAGGAGAAACCAGAC
TATCATATACCGAAGTGGTTCCTGGAATGGTGAGAGATTCAACGGAGTTC
CAGAGATGGACACCGATACTGATTCCATTGTGTTCAGCTTCTCCGATGAC
GCGCACGGCGTGTTCTACTATTTCTCCATCGGGAACGCTTCTTTGTTATC
GAGGCTAACGGTGACGTCAGATTCAGACGGTGAACTTCAACGGCGGACGT
GGATAGCGAGCAGCGAAACTTGGAACAAGTTCTGGTACGCACCGGCGGAT
CAATGCGACCATTACAGGGAGTGTGGTCCGTACGGATTGTGTGACAATAA
TGCATCGCCGGTTTGCAGATGTATGAAAGGGTTCAGCCCTAAGAACCCTC
AGGCTTGGAATCTGAGAGATGGATCTGGCGGGTGTGTGAGGAACACCGAT
CTGGATTGCCCCACTGACAAGTTCTTGCATCTTGAGAGCATGAAGCTGCC
GGAGACGACGACGGTGTTTGTTAACAAAAGTATGACGTTAACGGAATGTG
AGAGCCTGTGCCATCGGAATTGTTCATGCACTGCATATGCAAACATTGAT
ATCACAAATGGCGGAAGTGGTTGTGTTATGTGGCTTGGTCAACTCTTTGA
CTTGAGGAACTACCCTTCTGGCGGTGGCCAAGATCTCTATGTTCGATTAT
CTGCTGCTGATATAGGATCTGCTGGCTCCAAACATCGTAAAGCTGAGGCT
ATAGGCATCTCACTTAGTGTAGTTGCTATAGTTTTGGGATTGGTTGCTAT
TTGTTACTTAAGGAAGAAGAAACAACACAGAGGTTCAATCCACAGAAGTC
ATGATTTGCTAATGAATGAGGGGGTGCCTTCTAGAGGACACTCGGGTGAC
AGGAACATGGATGATCTAGAGTTGCCCATGTTTGATTTTGATACCTTAAC
AATGGCTACCAACAACTTCTCTCAAGATAATAAACTTGGACAAGGAGGAT
TTGGTAGTGTTTATAGGGGAAGTTTGATTGAAAGCCAAGAAATTGCTGTA
AAGAGGTTATCAAAAGACTCTGGACAAGGAATTGAGGAGTTTAAGAATGA
GGTCAAGTTAATTGTGAAGCTCCAACATCGAAACCTTGTTCGGCTGCTTG
GTTGCTGCATTGAGAAGGATGAGAAGATGTTGGTGTATGAATATATGGAA
AACAGAAGCCTTGACTCCATTTTGTTTGACAAAGTTAAAAGATCCTTGCT
AGATTGGAAAAGTCGATTCAATATTATATGTGGAATAGCTAGAGGACTTC
TTTATTTGCACCAAGATTCTAGATTTCGGATTATTCATAGGGATCTCAAA
GCAAGCAATATTCTACTTGACAGTGAAATGAACCCAAAGATATCTGACTT
TGGGATGGCCAGAATTTTTGGAAGTAATCAAACAGAAGCAAATACAATAA
GAGTTGTTGGAACATATGGTTATATGTCTCCTGAATATGCTATGGACGGA
AATTTCTCAGTAAAATCTGACGTTTTTAGTTTCGGAGTTCTCGTATTGGA
AATCATTACGGGCAAGAAAAATAGAGGGTTTTACTATGCCAATGATGAAT
TGAATCTTTTGGGCAACGTGTGGAGGCAATGGAATGAAGGAACTGCTTTA
GAAGTAGTTGATCAATCCATTGGCAATTCATATGCAGAATCTGAAGTTCT
AAGATGCATACATGTTGGTCTCTTATGTGTCCAAGAACGTGCAGAAGATA
GACCAACAATGTCCTCGGTAGTTTTAATGTTGAGTAGTGAAGCTGCATTA
ATGCCACGTCCTAAAAATCCTGGCTTTTCTCTAAGAAAGAATCATCCAGA
GACGGATTCATCTTCAAGTAATCAAGATAAAACATGGAGTGTGAATCAAG
TTACAGTCACAATGCTAAATGCTAGGTAGCGAAAGAAATTTAAAATCATA
CAATATACTTGTATATTCTCAACAGAATGAAAATTTTTCTTAATTCATTT
TTCCTGTTTTATAGTTGCGGCTTCTTCTAGATCTACTTTGATATTATTTT
GGTGTAATATGTAAGAAATGAATTCACTGATAGAAAAAAGGGAATATTTT
CCTTGGTTCAAACTATCTGTCATTTACACATTTTAACAAATATTTATTAC
GAGCTTCCTTTATTTTTCACAGCAATATAGTTGTGTGATTGTGTCTA
back to top
Protein Sequence

aradu.Aradu.B17TN.1 sequence

>aradu.Aradu.B17TN.1
QNQTFVLGFFGGSNTNYYLGIWYNNINPQTIVWVANRDNPIDNSTGYLKI
GDNGNFVLLNSSGNPAWSSNQTNAKNPVIQLLETGNLVLKDSEQSNNYLW
QSFDYPTDTLLPGMQMGWNFDTGIEKHLTSWKVTGEDPSSGDYTFKLDYR
GLPEIFLRRNQTIIYRSGSWNGERFNGVPEMDTDTDSIVFSFSDDAHGVF
YYFSIGNASLLSRLTVTSDSDGELQRRTWIASSETWNKFWYAPADQCDHY
RECGPYGLCDNNASPVCRCMKGFSPKNPQAWNLRDGSGGCVRNTDLDCPT
DKFLHLESMKLPETTTVFVNKSMTLTECESLCHRNCSCTAYANIDITNGG
SGCVMWLGQLFDLRNYPSGGGQDLYVRLSAADIGSAGSKHRKAEAIGISL
SVVAIVLGLVAICYLRKKKQHRGSIHRSHDLLMNEGVPSRGHSGDRNMDD
LELPMFDFDTLTMATNNFSQDNKLGQGGFGSVYRGSLIESQEIAVKRLSK
DSGQGIEEFKNEVKLIVKLQHRNLVRLLGCCIEKDEKMLVYEYMENRSLD
SILFDKVKRSLLDWKSRFNIICGIARGLLYLHQDSRFRIIHRDLKASNIL
LDSEMNPKISDFGMARIFGSNQTEANTIRVVGTYGYMSPEYAMDGNFSVK
SDVFSFGVLVLEIITGKKNRGFYYANDELNLLGNVWRQWNEGTALEVVDQ
SIGNSYAESEVLRCIHVGLLCVQERAEDRPTMSSVVLMLSSEAALMPRPK
NPGFSLRKNHPETDSSSSNQDKTWSVNQVTVTMLNAR.
back to top
Expression

Gene expression for aradu.Aradu.B17TN has been determined by its associated transcript, Adur31699_comp0_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.