Description
Gene Model Namearadu.Aradu.B63QG
Micro Synteny Viewaradu.Aradu.B63QG
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_B6F63Q
DescriptionNADP-dependent alkenal double bond reductase; IPR002085 (Alcohol dehydrogenase superfamily, zinc-type), IPR011032 (GroES (chaperonin 10)-like), IPR013149 (Alcohol dehydrogenase, C-terminal), IPR016040 (NAD(P)-binding domain); GO:0008270 (zinc ion binding), GO:0016491 (oxidoreductase activity), GO:0055114 (oxidation-reduction process)
Protein domainsG3DSA:3.40.50.720 G3DSA:3.90.180.10 PF00107 PTHR11695 PTHR11695:SF5 SSF50129 SSF51735
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.B63QG.1

Sequences
Gene Model Namearadu.Aradu.B63QG
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.B63QG.1 sequence

>aradu.Aradu.B63QG.1
GGTGTGCTAACCTATAAATAGAAATGAAAACTACAAATTACATATGATTA
ACCATCATGTATCTATCGATCATGGGTGAGAAGAGTAGTAATGATTGGAG
AGCAGAGGAAGTAAAGAACAAACAAGTTATACTGAGAGATTATGTGAGTG
GATATCCCAAAGAATCTGACATGTACATAGTAACAAGTACCATTAATAAA
CTGAAGGTTCCAGAAGGCTCAAATGGTGTGTTGGTGAAAAACTTGTACCT
TTCATGCGATCCAACCATGCAATTCCGCATGAGGAAAATTCCCCATTCCC
CTTCCCACCAATCCGAGTCTTATGTCCCTGGATCTCCCATTAATGGGTTT
GGAGTGGCTAAGGTTCTGGATTCAGGGCATGCTGAGTTTAGTGCTGGTGA
CTTAGTTTGGGGAACAACTAGTTGGGAAGAATATAGTGTCATTCAAAATC
CAGAGCAGCTCAAGAAAATTCACCACACTGATGTGCCCCTCACACATTAC
ACTGGACTTCTTGGGATGCCTGGAATTACTGCATATGCTGCAATCTATGA
AGTTGGTCTTCCAAAAAAGGGAGAATGTGTGTTCATCTCAGCAGCATCAG
GTGCTGTTGGTCAAATAGCTGGACAGTTTGCCAAATTGCTTGGTTGTTAT
GTGGTTGGAAGTGCTGGCACCCAACAAAAGATTCATCTTCTAAAAAACAA
GTTTGGTTTTGATGATGCCTTCAATTACAAGCAAGAGCCTGATTTGGATG
CTGCTTTAAAAAGGTGCTGCCCTGAAGGCATTGATTTCTACCTTGATCAT
GTTGGGGGGGAAAATGCTTGATGCAGTTCTGCTTAACATGAAGCTCCATG
GCCGAATCGCGATATGTGGAATGATTTCGCAATACAATCTTGATGAGCCT
GAACTCCTAAGGAATGTGATGCTGCTGGCATTGAAGAGACTTACTGTGAA
AGGATTCACACACAGAGATTACCATCATCTGTATCCTAAGATCTTGGAGC
TTGTATTGCCTTACATTAGGGACAAGAAGATTTTCTATGTTGAAGACATT
GTTGAAGGACTTGAGAATGGACCCGCTGCTCTTGTTGGACTATTCACTGG
TCGCAACTTTGGAAAGCAAATTGTTGCCCTTCCTCCTCAATGATCAATCA
TAATCATGCATCATAGTAGGGTTAAAAAAGTTAAATAAAAAGTTAATTTT
TCTTGTGATTGAA
back to top
Protein Sequence

aradu.Aradu.B63QG.1 sequence

>aradu.Aradu.B63QG.1
MYLSIMGEKSSNDWRAEEVKNKQVILRDYVSGYPKESDMYIVTSTINKLK
VPEGSNGVLVKNLYLSCDPTMQFRMRKIPHSPSHQSESYVPGSPINGFGV
AKVLDSGHAEFSAGDLVWGTTSWEEYSVIQNPEQLKKIHHTDVPLTHYTG
LLGMPGITAYAAIYEVGLPKKGECVFISAASGAVGQIAGQFAKLLGCYVV
GSAGTQQKIHLLKNKFGFDDAFNYKQEPDLDAALKRCCPEGIDFYLDHVG
GENA.
back to top
Expression

Gene expression for aradu.Aradu.B63QG has been determined by its associated transcript, Adur30405_comp0_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.