Description
Gene Model Namearadu.Aradu.BP0GU
Micro Synteny Viewaradu.Aradu.BP0GU
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_J8TV2Q
DescriptionNAD(P)-binding Rossmann-fold superfamily protein; IPR002347 (Glucose/ribitol dehydrogenase); GO:0008152 (metabolic process), GO:0016491 (oxidoreductase activity)
Protein domainsG3DSA:3.40.50.720 PF00106 PR00081 PTHR24322 PTHR24322:SF17 SSF51735
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.BP0GU.1

Sequences
Gene Model Namearadu.Aradu.BP0GU
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.BP0GU.1 sequence

>aradu.Aradu.BP0GU.1
TATCTGCATGTACGCTAGACATATATAGAGAGAGAGAGATATCAATGCAC
AGAAGCCTACCTAACTAGCATCTGCAAAATCAATTCAAAAGACATATACC
TTTCCGATTCCAACTTTAATTAATCACTCTCTCTCACCACACACCACTAC
AAGAACAAGTAAGACATTAAACAGTTTCTATCTACCAACCAAATCACAAG
AGGTAAAGTTAAGATGCTGGAAACAGTTAAATACCTGATAGGGTCGCCGG
GTCCAAGCGGGTTCGGGTCCAAGTCCAACGCCGAACAAGTCACGGAAAAC
TCCGATCTGCGCTCACTCACGGCCATTATTACCGGAATAGGAGCTGAAAC
GGCAAGAGTTCTGGCGAAACGAGGAGCGAGGCTGGTTCTGCCAGCGCGGA
GCCTGAAAGCCGCGGAAGATACAAAGGCTCGCATAGTATCGGAGTTTCCA
GATGCTGACGTCATGGTTATGCCGCTCGACCTCAGTTCTCTCACTTCTGT
TAGGAACTTCGTGGCTCACTTCCACTCTCTCCGTTTGCCGCTCAATCTCC
TCATGTTTGTAACATGCAGACAAACTTCCCCATTTTATTTTCTCTATATT
CCTTATCTCAAAAAAAGGAATGAGTCTTTCTCATCCACGATGATCGAGAC
GGCAGAGAAGACAGGGGTGCAAGGGAGGATAGTGAACGTGTCGTCGAGCA
TCCACGCTTGGTTTTCCGGTGATGTCATCTCATATTTAGCCTCTATTAGC
CGCAACAACAAAAGCCATTACGACGCCACACGTGCTTATGCTCTTTCCAA
GCTCGCCAACGTTTTCCACACCAACCAACTTGCTCGCAAGCTCCAGCAAA
TGGGGGCGAACGTGACAGTGAACTGTGTGCACCCGGGGATCGTGAGAACC
AGACTCACTAGAGAGCGTGAGGGATTACTCACAGTTTTCTTTTTGGCTTC
CAAGCTCTTAAAGACCATTCCACAGGCAGCAGCAACATCATGTTATGTGG
CGACCCACCCAAGGTTGCATAACGTGAGTGGCAAGTACTTTGCAGATTGT
AACGAGGCTGTAACATCAAAGTTGGGATCCAACTCAACCCAAGCTTCAAG
GTTATGGGCCGTTTCTGAATTCATGCTCACCAGGGGTCCTAAAGCTGCCT
TTGACCTACTCAATCACCTTCACTTTTGATACTCTTGCTGGGGCCAATGC
AAAAAGACACAGCTATAGAATTAGGATTTTATGGTAAACAAAAAGATAAA
TAGGTGTAGTACAGTGTAGTTGGAGATTGAAGCCACTTTGCAACCTAAAA
AAAAGGGAAGGATTTTGTGCTCTCTTGATTTGATTAGACTCTACTGCAAC
TCAAGATAACAGGAAAGAATTAACTTTGCAGAGTCTTATGATCGATATTG
AATTATTGATTACTATATTTTGGTTCTCATTACTTAGGGTAAACGATAGG
CATACTTGTTGGTTTTATTTAGTTAAAATTTTAAGATGTATTTGCTATAG
GTAGTACTAGTTAGATTGAGTAACTATGATGATTCAATGATTATATAGCT
AGCTTGGATTATATATATATTAACATGGTGGACCTTAGACTATAAGGGAA
AGTACTTGGAAATACATTCGATTTTTTCTGTCAATATGATGTATGTATAT
GGGGATGTATGTTAATTAATTGTGCTTTAATTTGTGTATCTGGGTTTGCA
TAGTAGTACAAACATATAAACGAG
back to top
Protein Sequence

aradu.Aradu.BP0GU.1 sequence

>aradu.Aradu.BP0GU.1
MLETVKYLIGSPGPSGFGSKSNAEQVTENSDLRSLTAIITGIGAETARVL
AKRGARLVLPARSLKAAEDTKARIVSEFPDADVMVMPLDLSSLTSVRNFV
AHFHSLRLPLNLLMFVTCRQTSPFYFLYIPYLKKRNESFSSTMIETAEKT
GVQGRIVNVSSSIHAWFSGDVISYLASISRNNKSHYDATRAYALSKLANV
FHTNQLARKLQQMGANVTVNCVHPGIVRTRLTREREGLLTVFFLASKLLK
TIPQAAATSCYVATHPRLHNVSGKYFADCNEAVTSKLGSNSTQASRLWAV
SEFMLTRGPKAAFDLLNHLHF.
back to top
Expression

Gene expression for aradu.Aradu.BP0GU has been determined by its associated transcript, Adur33951_comp0_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.