Description
Gene Model Namearadu.Aradu.BZN6F
Micro Synteny Viewaradu.Aradu.BZN6F
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_3646NZ
Descriptionremorin-like [Glycine max]; IPR005516 (Remorin, C-terminal)
Protein domainsCoil PF03763 PTHR31471 PTHR31471:SF1
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.BZN6F.1

Sequences
Gene Model Namearadu.Aradu.BZN6F
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.BZN6F.1 sequence

>aradu.Aradu.BZN6F.1
ATGAAGAAAACGCCTTGTTCCTCTTATCAGAAGAACCACCTGATTGGGTC
CTTCCCAAGTCCAGGGGCACCAAACTACAGAGAGAAAGGCGCAGTGATAA
GTTCCCAAAAGGGATGGAGCTCAGAGAGAGTAGCAAAAGCTTCAAGCAGC
AGCATAAGAAGACACACAATGTCTGGTCTCACACCCTTCTTCAGCGCCGG
CGGAAGAACAATGCCTTCCAAATGGGACGAAGCTGAGAGATGGATTTGTA
GCCCAGTTTCTTCTTCTTCTGCTGACGTCAGACAACCTCATCAGCGTAGA
CCCAAGTCCATAAGCGGCCCAATTGTTGATCATGGTCAACAAGGTCCTCA
AGGTTTGGTTGTGAGGAACTTGGTTGTTGGTTCACCGTTCTCCACCGGTG
TGCTTGCACCGCTTGCTGTTTCTGTTCACCATTATGATGATGCTTATCAT
TTTGGGGATGGAATGGATTCTTCTGGTAGTCCTCTGCTCCACGCTGCACC
GCTCTGCCCTCAACACTCATATCACCCATCGTCTCCTATCTGCCAAGATT
TACTAGATAAGAATCACGATGAGGATGAGATGATGTTCTCAAAATGTGAC
AAAGGAACACAAATGAGCCCTGCAGATGAAACAGAGAGTGATCTGCATTC
ATCTCCAGAATCTTGCACCGGTTCAGCCATGGTTCAACCGGGTTGCCATT
CCCCTAAGCTTGAGGTCAGAGATGTGCAGGTTGATAGCCAAGCTACTCTT
ATCAGGGGATCCAAAAGGCACGCAACGAAATCTCTGAGTAGCCACAAAGA
GTTCAGAGAAAATAGTACTGAAACCAGCCAATTTTCGCCTTGGGATATTG
AAGACTCAGCCTCAGACATTTCCAAGTTAAAGAGAGAGGAAGCCAAAATC
ATTGCGTGGGAGAATTTGCAGAAAGCAAAGGCCGAAGCCGCAATACGCAA
ACTTGAGATGAAATTGGAGAAGAAGCGATCATCATCAATGGATAAGATTC
TAAGCAAGTTGAGAAAGGCAGAGACAAAAGCTGAAAATATGAGAAGCTCG
ATCCCTGAACAACAAGAAAACCGGACTTCCAAGAACTGCAAAGTGTTTTC
ATTCCCGATATGGTCCCCAATCAGCTGCTTCAGCACTCATGCTGTTGCTG
ACTGAACCACTCAAGTCATTATGATTTTGACCCTTCTAGTACTAGTGTGC
TACACTCTTGTCTTAATTCATGCCGTTTCATGCATTTGTATATACCACAC
TTGTTTATGGG
back to top
Protein Sequence

aradu.Aradu.BZN6F.1 sequence

>aradu.Aradu.BZN6F.1
MKKTPCSSYQKNHLIGSFPSPGAPNYREKGAVISSQKGWSSERVAKASSS
SIRRHTMSGLTPFFSAGGRTMPSKWDEAERWICSPVSSSSADVRQPHQRR
PKSISGPIVDHGQQGPQGLVVRNLVVGSPFSTGVLAPLAVSVHHYDDAYH
FGDGMDSSGSPLLHAAPLCPQHSYHPSSPICQDLLDKNHDEDEMMFSKCD
KGTQMSPADETESDLHSSPESCTGSAMVQPGCHSPKLEVRDVQVDSQATL
IRGSKRHATKSLSSHKEFRENSTETSQFSPWDIEDSASDISKLKREEAKI
IAWENLQKAKAEAAIRKLEMKLEKKRSSSMDKILSKLRKAETKAENMRSS
IPEQQENRTSKNCKVFSFPIWSPISCFSTHAVAD.
back to top