Description
Gene Model Namearadu.Aradu.C3RV0
Micro Synteny Viewaradu.Aradu.C3RV0
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_21BXZQ
Descriptionseed linoleate 9S-lipoxygenase; IPR000907 (Lipoxygenase), IPR008976 (Lipase/lipooxygenase, PLAT/LH2), IPR027433 (Lipoxygenase, domain 3); GO:0005506 (iron ion binding), GO:0005515 (protein binding), GO:0016165 (linoleate 13S-lipoxygenase activity), GO:0046872 (metal ion binding), GO:0055114 (oxidation-reduction process)
Protein domainsG3DSA:1.20.245.10 G3DSA:2.60.60.20 G3DSA:3.10.450.60 G3DSA:4.10.372.10 G3DSA:4.10.375.10 PF00305 PF01477 PR00087 PR00468 PS00081 PS00711 PS50095 PS51393 PTHR11771 PTHR11771:SF2 SM00308 SSF48484 SSF49723
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.C3RV0.1

Sequences
Gene Model Namearadu.Aradu.C3RV0
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.C3RV0.1 sequence

>aradu.Aradu.C3RV0.1
CACACTAACAAAAATAAGCTCTTACACTTCATTCTAAACTGCCAAAGTTT
CTGTTTTCTCTCTGAAACATGTTTAAGAACATCATCGACGCTGTCACTGG
CGGAGGCGACATGCAGAACCACCGCCAGACAGTGAAAGGGACGGTGGTGC
TCATGAAAAAGAACGTGTTGGACTTCAACGATTTCAGTGCTTCCCTCCTC
GATCGCCTTCATGAGTTTCTCGGAAAACGAGTCTCTCTCCAACTCATAAG
TGCCGTCAACGCTGATAATCATGGAAATGGGCTGAAGGGGAAGCTAGGTA
AGGCTGCATACTTGGAAGATTGGATCACCACATTCACACCATTGACAGCA
GGAGAAGCAGCATTCACAGTTACTTTTGATTGGGACAATGAGGAGATAGG
AACACCAGGTGCATTTCTAATTAGGAACAACCATCACAGTGAGTTTTACC
TTAAAAGCCTCACACTTGAAGATGTTCCTTCCCATGGTGTCATTCACTTT
CCTTGTAATTCTTGGGTTTACCCTGCTAGTAAATATCAAAACGACCGCGT
TTTCTTCTCCAACAAGACATACCTTCCAGCTGAAACACCAATATCACTGC
TCAAGTATAGAGAAGAAGAACTAGAGAATTTAAGAGGGGATGGAAAGGGC
CAGCTCCAAGAGTGGGACAGAGTCTATGATTATGAAGTCTACAATGACCT
GGGAAATCCAGATAAGGGTCCACAACATGCTCGTCCAGTTCTTGGAGGGT
CCACCGAATATCCATACCCTCGAAGAGGAAGAACCGGTAGAGCACCAGCT
AAATCAGATCCAAAGTATGAGAGTAGGTTGAATCTTGCTTTGAGCTTAAA
CATATATGTTCCAAGGGATGAAAGATTTGGTCACTTGAAGTTGGCGGATT
TTCTCTCATATGCACTGAAATCTATAGTCCAAGTTCTCAAACCGGAATTC
GAATCAATATTCGACAAAACCCCTAATGAGTTTGACAGCTTTGAAGATGT
ACTCAAACTATATGAAGGTGGACTTGAAGTGCCTGAGGGTGTAATTAAGG
TTATTCGGGATAATGTTCCTCTTGAGATGCTCAAGGAAATTTTTCGCACC
GATGGTGAAAGGTTCCTCAAATTTCCTCTGCCTCAAGTGATTGCAGTGGA
TAAGTTTGCATGGAGAACAGACGAAGAATTTGCGAGAGAGATGTTGGCCG
GAATAAACCCGGTTATGATCCGCCGTCTCGAAGAATTCCCACCAGCAAGC
AAGCTAGACCCAAAAGTCTACGGTGATCAAACCAGCACAATAACAAAAGA
ACACATTGAAAGTAATTTGGAAGGCCACACAATTAATGAGGTAATCCGAG
AAAGGAAGTTATTCATATTGGATCACCATGATGCACTAATGCCATACCTG
AGAAGGATAAACTCCACTTCTACAAAGACTTATGCTTCCAGAACACTTCT
TTTGTTGCAAAAGAATGGGACATTAAAGCCCCTCGCCATCGAGCTGAGTT
TGCCGCATCCCGAGGGAGATCAACATGGTGCCATAAGTAAAGTTTTTGTC
CCCGAAGAAAATTCCTTGTGGCAACTCGCCAAAGGTTATGTCGGAGTAGT
CGACTCCGGCTATCATCAACTTATCAGCCATTGGCTACATACTCATGCAG
TCATCGAGCCGTTTATTATCGCGACGAACAGGCAGCTTAGTGTTCTTCAT
CCAATTTATAAGCTGTTACATCCTCACTATCGCGACACCATGAATATAAA
TGCGCTTGGAAGGCAGATCCTCATCAATGCAGGTGGTGCTCTAGAGGTAA
CAGTTTTTACATCAAAATATTCCATGGAGTTTTCCTCTATGCTTTATAAA
GATTGGGTTTTCCCGGAGCAAGCACTACCTCAAGATCTTCTCAAGAGAGG
AGTGGCTGTTAAAGATTCAAGTTGCCCACACGGCATTAAGCTATTGATCG
AGGATTACCCTTTTGCAGTTGATGGACTAGAAATCTGGTTCGCCATCAAG
ATATGGGTTGAAGACTATTGCAGCGTTTACTACAAGGACGATGAGTCAAT
CAAGAAAGACGCAGAACTCCAATCTTGGTGGAAGGAAATAAGGGAGAAGG
GCCATGGTGACAAGAAAGACGAGCCATGGTGGCCAAAGATGCAGACACGT
GAGGAGCTCATTGAAACATGCGCCATCATTATATGGACCGCTTCGGCTCT
TCATGCCGCCATCAACTTCGGACAGTATCCGTACGGAGGCTACCCGCCGA
ACCGTCCAGCCATAAGTAGCAAATTGGTGCCGGAAAAAGGAACGCCCGAG
TATGATGAACTGTTGGCGAATCCTGATAAGACTTATCTGAAAACATTCAC
TTCACAGTTCAAAGCTGTTCTTGGAATTTCACTTGTGGAAATCTTGTCTA
GGCATTCTAGTGATGAGGTGTACTTAGGGCAGAGAGACACTGAAAATTGG
ACGTCGGATGCTGACGCGTTAGAAGCGTTTGCCAAGTTCGGGAAGAAGAT
TGAAGATATTGAGGAAGGGATGAAGAGAATGAACAATGATGAGAAACTGA
GGAACAGATATGGACCTGTTAAGATGCCCTACACTTTGCTTTATCCTTCT
AGTGAAGGTGGACTAACTGGAAGAGGGATTCCAAATAGTGTCTCAATCTA
AACTTGTGCCTAGAGGGCTTATAGCTATGTTATGTTATTTGCTTGACTTT
GATGGATCTATCAGATAGTGTCTTAATTATCAAATCCTTTCAATTTCAAT
GGGTGTGTCTGCTGTGCTCCCTCTTAGTCCCCTTCTAGCAATTGCAGTAG
CCTGTTTAGCTGGTCAATGTTATTTTTAATTCTATTTATCTGATCCAATG
GTTGCCGCTTGGCATGGCTTGTTCTTCACTTCTTTGTCGCCTCTGCCCTT
TAGTTTTAATTTGAT
back to top
Protein Sequence

aradu.Aradu.C3RV0.1 sequence

>aradu.Aradu.C3RV0.1
MFKNIIDAVTGGGDMQNHRQTVKGTVVLMKKNVLDFNDFSASLLDRLHEF
LGKRVSLQLISAVNADNHGNGLKGKLGKAAYLEDWITTFTPLTAGEAAFT
VTFDWDNEEIGTPGAFLIRNNHHSEFYLKSLTLEDVPSHGVIHFPCNSWV
YPASKYQNDRVFFSNKTYLPAETPISLLKYREEELENLRGDGKGQLQEWD
RVYDYEVYNDLGNPDKGPQHARPVLGGSTEYPYPRRGRTGRAPAKSDPKY
ESRLNLALSLNIYVPRDERFGHLKLADFLSYALKSIVQVLKPEFESIFDK
TPNEFDSFEDVLKLYEGGLEVPEGVIKVIRDNVPLEMLKEIFRTDGERFL
KFPLPQVIAVDKFAWRTDEEFAREMLAGINPVMIRRLEEFPPASKLDPKV
YGDQTSTITKEHIESNLEGHTINEVIRERKLFILDHHDALMPYLRRINST
STKTYASRTLLLLQKNGTLKPLAIELSLPHPEGDQHGAISKVFVPEENSL
WQLAKGYVGVVDSGYHQLISHWLHTHAVIEPFIIATNRQLSVLHPIYKLL
HPHYRDTMNINALGRQILINAGGALEVTVFTSKYSMEFSSMLYKDWVFPE
QALPQDLLKRGVAVKDSSCPHGIKLLIEDYPFAVDGLEIWFAIKIWVEDY
CSVYYKDDESIKKDAELQSWWKEIREKGHGDKKDEPWWPKMQTREELIET
CAIIIWTASALHAAINFGQYPYGGYPPNRPAISSKLVPEKGTPEYDELLA
NPDKTYLKTFTSQFKAVLGISLVEILSRHSSDEVYLGQRDTENWTSDADA
LEAFAKFGKKIEDIEEGMKRMNNDEKLRNRYGPVKMPYTLLYPSSEGGLT
GRGIPNSVSI.
back to top
Expression

Gene expression for aradu.Aradu.C3RV0 has been determined by its associated transcript, Adur15609_comp0_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.