Description
Gene Model Namearadu.Aradu.C6XR1
Micro Synteny Viewaradu.Aradu.C6XR1
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_NQXBB1
Descriptionaldo/keto reductase family oxidoreductase; IPR001395 (Aldo/keto reductase), IPR023210 (NADP-dependent oxidoreductase domain); GO:0016491 (oxidoreductase activity), GO:0055114 (oxidation-reduction process)
Protein domainsG3DSA:3.20.20.100 PF00248 PR00069 PTHR11732 PTHR11732:SF123 SSF51430
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.C6XR1.1

Sequences
Gene Model Namearadu.Aradu.C6XR1
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.C6XR1.1 sequence

>aradu.Aradu.C6XR1.1
AGTCAATTGGCTTGATCCGCAACAAGGTGCAGGATTCAACGGTTACCACA
CAAAATACATCAGAACACGACCTCCAAACAACTAACCAACAGTTCAGTTG
TGTTTGTGTTGCTGAATCTGCTGAGAACTTTAAATCTATTTTCTTATGCT
TTTACCAAGACTGAGCAATTATGGCACTCTCAGCATTGAGTCTTGGCCCT
TCAAACCTTAACCCCTTTTCATATTCCATATTCAAGTCTCTCAAGCTCCC
TCCTTTCTTGCAAACTCAGAAGGTGAAGATAGGGCCTCTGAGTGTGTCTC
CGATGGGGTTTGGAACATGGGCATGGGGTAATCAACTTCTTTGGGGTTAT
CAAGAATCCATGGATAACGAGCTTCAACAAGTGTTCAATATTGCTCTGGA
GAATGGTGTCAATCTATTTGACACTGCTGATTCTTATGGCACTGGAAGCT
TAAATGGCCAGAGCGAGAAGCTTCTTGGAAGGTTCATCCGAAATTTTCGA
GAACAAAAAGGGAGTGGCAGTGACAGTGACATAGTAATTGCTACAAAGTT
TGCAGCATATCCATGGCGCCTTACGCCAGGCCAGTTTGTGAATGCTTGCA
GGGCTTCACTAGAAAGGATGCAAATTGAGCAAATTGGGATAGGTCAACTA
CATTGGTCAACTGCAAATTATGCCCCTTTTCAGGAATTGGCGCTTTGGGA
TGGCTTGGTGACAATGTATGATAAGGGTTTAGTTAAAGCTGTTGGAGTAA
GCAATTATGGACCAAAGCAGCTTTTGAAGATACATGATTATTTGAAAAAG
TGTGGAGTCCCTTTATGTTCTGCCCAGGTGCAATTTTCTTTGCTAAGCAT
GGGGGAAGATCAACTGGAGATAAAGAGCATATGTGATTCACTGGGTATTC
AATTGATTGCTTATAGTCCCTTAGGACTTGGAATGCTCACTGGGAAATAC
TCACCTTCCACACTTCCAACTGGCCCAAGGGGGTTGCTATTTAAGCAAAT
ACTTCCAGGCCTAGATCCTTTATTAAGTTCCTTGAGAGACATTGCAAACA
AAAGGCGCAAAACAATACACAATTCCAATTCCGGGAGTGAAGACAATAAA
GCAAGTAAAAGAGAACTTGGGTGCTCTTGGTTGGCGCTTATCTTCGGAAG
AGGTGCTTCAGTTGGAGTATGCAGCGCAGGAATCACCTCGCAAGATGATC
CAGAACATTTTCCAAACCAGATAATATCTGCGGCGGATGCCTCTATACTA
GGCATATTTCAAGCTACGTAATTCATCATTGTTTATTATCCATATAATGA
AGTGAAGGATTCGGCAAAGATGACCACTTTGAATGCAATGGCAACAATAT
TCAATATACTTCACCATTTGCACGCGTAGTGTGATGAATTAATACCATAA
CGCCTCAACATAATTTTGAACAAGTCATCTTTCGCGCCACTAAAACATTT
GTTACCTCAGATAATTACGGATTTAGTGCCACAAA
back to top
Protein Sequence

aradu.Aradu.C6XR1.1 sequence

>aradu.Aradu.C6XR1.1
MALSALSLGPSNLNPFSYSIFKSLKLPPFLQTQKVKIGPLSVSPMGFGTW
AWGNQLLWGYQESMDNELQQVFNIALENGVNLFDTADSYGTGSLNGQSEK
LLGRFIRNFREQKGSGSDSDIVIATKFAAYPWRLTPGQFVNACRASLERM
QIEQIGIGQLHWSTANYAPFQELALWDGLVTMYDKGLVKAVGVSNYGPKQ
LLKIHDYLKKCGVPLCSAQVQFSLLSMGEDQLEIKSICDSLGIQLIAYSP
LGLGMLTGKYSPSTLPTGPRGLLFKQILPGLDPLLSSLRDIANKRRKTIH
NSNSGSEDNKASKRELGCSWLALIFGRGASVGVCSAGITSQDDPEHFPNQ
IISAADASILGIFQAT.
back to top