Description
Gene Model Namearadu.Aradu.D6ZEJ
Micro Synteny Viewaradu.Aradu.D6ZEJ
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_FJTD21
Descriptionuncharacterized protein LOC100778822 isoform X6 [Glycine max]; IPR004252 (Probable transposase, Ptta/En/Spm, plant)
Protein domainsCoil PF03004
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.D6ZEJ.1

Sequences
Gene Model Namearadu.Aradu.D6ZEJ
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.D6ZEJ.1 sequence

>aradu.Aradu.D6ZEJ.1
ATGGCTCCTCGAGTCAAGGGTAAAGGTGTCAAGGGTCATAGAGGTTCTCG
AACCACCGCCGCAGCCGCTATTACCACCAACTCCACCTCTTCTGGGACTT
CAGTTGTGCCAGATTTTCAGTCAGGACCACTTACCCAGCAACCATATTTG
ATGGTGCCTAATCAAGGCTACACTGGTCTTCCTCCACCAACTTGGCCTAC
TCCAGGATGTATGGGCCCTCCACCACCCCCTCTTCCAATTTCGATTCCTC
CTCCGTCTCGCAATTCCAGCCTATTAGTTGATTCAGAGACACCTGGAAGC
TCTAGTACATCTCCTCCATCAAAAACTGCATCGGTTCCTAATGTTGTCAC
AAAACAAAGATTGGTTCCAGATGGAAAAACAAGTTGGTTACCTTTCCCTC
CTGGTTCGCAAAAGATTACAGAGATCATCAAGAAACGGTATGATAAACTA
TATAAAAAGTTTGGGGATGTCCCTCTTCTGACAAAGAAGCTTTGGTTTAA
GGAGTGGAAGGCTTTCAAATATAGGACAAGTAAGCGATTTAGCCAAATGA
TGTCGGATATCCGTGAGGGTGTGGATACAACCCACGAATGGCTAATTCCT
GCTTACAAAAAGTTGTTGGAAAAGTACTGGGAAACGGATGAGAAATGGAA
AAATATAAGGAAAAAAGCGAGGGAGAATCCAGTGTCACTCTTAGGTGGTT
CTATCCATTGCAGTGGTTCTATTCCACTGAGCTCAACTATAGAGAGGATG
AAGCAGTTAGAACGTACACCAACTCATGAGGAAGTCTTCAAGAAAACCCA
CACACTTAAAAGTGACAAGTCTAAATGGGTGGACAAACGCTCTCAAGACA
CTCATGAGAAGTTTATAAAAAAGTTAGCAGAAGTTCAGGCCCAACATGTC
GAGGCTCAAGCACAAGGAATGGAGCTACCACCAATTGATGAAGACTTGAT
TTGGGAGGAAGTGTGTGGTGGGCAAAAGAAGAATCGATCTATAACCACTT
CTGCCAACTCTGTATCTGGAAGAGCATCTACAAATCAAAATTTTGTTCCT
GATTTGCGAGAACAGATTCATAATCTCAATGAAGAGCTTTTTCAACGTGT
TACTCAACAGACAGATGAGCGTATTAGTAAGTTGTTAGATACACGCTTGG
CTCCTTTGGAAAAGACTCAAAAGAAGTTAGAAAAGTTAGAACGGGCAATT
GGAAAGGCCAAGAAGGAAAAGCTGAAACAGAAGAGATGGAATGAGGCTTA
TGTTAGCTATTACAAGAAGGTTAGAGCGTCAAGTATGGTTGAAGATGACA
CTGAGGACTATAGTTGA
back to top
Protein Sequence

aradu.Aradu.D6ZEJ.1 sequence

>aradu.Aradu.D6ZEJ.1
MAPRVKGKGVKGHRGSRTTAAAAITTNSTSSGTSVVPDFQSGPLTQQPYL
MVPNQGYTGLPPPTWPTPGCMGPPPPPLPISIPPPSRNSSLLVDSETPGS
SSTSPPSKTASVPNVVTKQRLVPDGKTSWLPFPPGSQKITEIIKKRYDKL
YKKFGDVPLLTKKLWFKEWKAFKYRTSKRFSQMMSDIREGVDTTHEWLIP
AYKKLLEKYWETDEKWKNIRKKARENPVSLLGGSIHCSGSIPLSSTIERM
KQLERTPTHEEVFKKTHTLKSDKSKWVDKRSQDTHEKFIKKLAEVQAQHV
EAQAQGMELPPIDEDLIWEEVCGGQKKNRSITTSANSVSGRASTNQNFVP
DLREQIHNLNEELFQRVTQQTDERISKLLDTRLAPLEKTQKKLEKLERAI
GKAKKEKLKQKRWNEAYVSYYKKVRASSMVEDDTEDYS.
back to top