Description
Gene Model Namearadu.Aradu.D8WXX
Micro Synteny Viewaradu.Aradu.D8WXX
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_0LJ8MZ
Descriptionsenescence-associated protein, putative
Protein domains
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.D8WXX.1

Sequences
Gene Model Namearadu.Aradu.D8WXX
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.D8WXX.1 sequence

>aradu.Aradu.D8WXX.1
ATGCTGGCCGTCCACACCTGGGCAGGGGAGGGACGAATCGAAGCGACAAG
GGCTGAATCTCAGTGGATCGTGGCAGCAAGGCCACTCTGCCACTTACAAT
ACCCCGTCGCGTATTTAAGTCGTCTGCAAAGGATTCTACCCGCCGCTCGT
TCGGAAAAGCGCTTCAAGGCATCCCCACAGGGCTCGTCCGCCCTGGGGGC
GTCGCCAACGGCACGTGCCTCTGGGGGGCCAGGCCCCCTACTGCTGGTCG
GCAAACGAGCGGCGGGCGCACGCGTCGCTTCTAGCCCGGATTCTGACTTA
GAGGCGTTCAGTCATAATCCAACGCACGGTAGCTTCGCGCCACTGGCTTT
TCAACCAAGTGCGATGACCAATTGTGCGAATCAAGGGTTCCTCTCGTACT
AG
back to top
Protein Sequence

aradu.Aradu.D8WXX.1 sequence

>aradu.Aradu.D8WXX.1
MLAVHTWAGEGRIEATRAESQWIVAARPLCHLQYPVAYLSRLQRILPAAR
SEKRFKASPQGSSALGASPTARASGGPGPLLLVGKRAAGARVASSPDSDL
EAFSHNPTHGSFAPLAFQPSAMTNCANQGFLSY.
back to top