Description
Gene Model Namearadu.Aradu.DMF7Y
Micro Synteny Viewaradu.Aradu.DMF7Y
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_LCSPRW
DescriptionCRT (chloroquine-resistance transporter)-like transporter 2
Protein domainsPTHR31326 PTHR31326:SF0 SSF103481
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.DMF7Y.1

Sequences
Gene Model Namearadu.Aradu.DMF7Y
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.DMF7Y.1 sequence

>aradu.Aradu.DMF7Y.1
ATGACGCATTCTCTAACGTCGTCGTTTCATTCCTTCTTCTTCTTCCCTCC
TTCTTCATCATCCGTACAACTCAACACACCAAAGCTTCAACTTCTGTTAC
CAATGTCATCAAATTCTCAACCGCTTCCCCTCAAATTCTCTCACACAAAT
AGAACAAGAACCACCACCACCAACAACAATCGCCACAAGATTCGAGCTTC
GTCCTCAACCGATGATCCTTCACCATCTTCATCAAGTGCGACGAATTTCG
TTTTGTTCAGTTCCGCTGCTCTAACTGTTACATTGGCGGTGGCTAATCGT
GTGCTTTATAAGCTTGCTCTCGTTCCCATGAAAGATTACCCCTTTTTCCT
TGCTCAGTTCACCACATTTGGGTATGTGGTTGTGTATTTTAGCATATTGT
ATATCAGATATAGGGCAGGTATTGTAAGTGACGAGATGCTAGCCATTCCG
AAACTTCGCTTTCTGGCCATTGGGTTTCTTGAAGCTTTGGGTGTGGCCAC
TGGAATGTTTGCTGCAGCTGTACTTCCTGGACCAGTCATACCCGTATTGA
GTCAGACTTTTTTAGTTTGGCAGCTAATGATTTCTGTTCTTCTCTTGGGG
AGAAGGTACTCAATCAACCAATTGGTTGGATGTTTACTTGTAGCTAGTGG
AGTTGTGGTGTCTATTACAAGTGGCTCAAACACGGGTCAGATGCTCTCTG
AAGTTGAGTTCTTTTGGCCAGCATTGATGATTGTTTCCAGTGCTTTTCAA
GCTGCGGCTTCAGTAATCAAGGAGTCTGTTTTCGTTGATAATGCCATTCA
ATTGAAGGTAATTATTATTATTATTATTATTATTTGGGTTTTGGGGGGCG
GGCAGAAGTCACTAGATATATTTGTGGTCAATTCTTTTGGATCTGGCTTT
CAGGCTCTGTTTGTACTTCTTTTTCTACCTTTACTTTCTAACTTGAAAGG
CATACCATTCGTTCAACTTCCTTCGTATCTTAAAAGTGGAGCTGGTTGCT
TTCTGAACCTTGGAACTCATAAATCAAGTAAGCTCTAATACATTGACCGG
AATTGATGTACATGCCTTGCCACATCATCTAGCTTTTAGAACACTATCAG
ATTATGTATTATGAGCATGGCATTTTTTAGGGTGCATTCGTATTATCGTC
TACATTCCAATTTCACGTTATGTGACTTAAATCTCACCGAAAACATGGGA
TTCTGATGTTAGGATCTCCAACTGCAATGTGGTTCACCAGGTTTCATATC
ATAATTTTATAACCTACCCTATATGGTGGAATCATAATTTTAAATGTTTC
AGATCAGAATTTCTTAAATATGCCCAATCTAGATAAAAAAAAAGAGAGCT
TGGTGGCAATAAACTCTCATGACTTTCATTACATCCAATCAATCAAAATG
AGAATCTATAAGCTCTTCTTTCCCGTTAATAATTTGTTCGAAACTTTCTT
GTCCCAAGTTGTAATTTGGCCACTTTCGTTCATCATGTCTTAGGCTGTGA
CGGTGCTCCCTGGCTTCCCCTGCTTTATATAGTTACCAACTTGGCATTCA
ATATATCGTTGCTTAACGTGGTAAAAACCTCCTCTGCAGTTGTTGCTTCT
CTTATGGTTATGATTTGCAGTGCCGATTTCCGTCATCATTCTTTCCCTTC
CGTTGCCTTATCTTCCCGAGGGAACAAGCCTGAGCCCAGTTTTTGTAGTT
GGCTGCGCCATCCTTGTATCTGGTCTTTATCTGTATAACACAACCAGAGC
TGCCAAGAATAGTACTAAATCTGATTGAAGCGCATCCGTTCCACAAAACC
ATTGCTGAGAAGTAACTCCCAAACTACCAAGCAGCCTATCTACTCACTCA
ACTATCAGTCTTGAGGCAATCTATCTTGGTGAAATGTATTTATTGACTTT
GTCCAATTCTACGTGTACTCATGTACAGTATTTTTTACTAGTATTATTTT
TTGGATTCTGATTAGTGTGAGGTAAGATCAGTTCAATTTCTATTTCTCTT
TACTGTCTTTGTCTAAGCGATTGGATCATTTTTTCATTGTAGTCTTTTGT
TGAATAGTTAAGTTACATATGCCACATAAGCTCCGGAAGTATACATTTAA
C
back to top
Protein Sequence

aradu.Aradu.DMF7Y.1 sequence

>aradu.Aradu.DMF7Y.1
MTHSLTSSFHSFFFFPPSSSSVQLNTPKLQLLLPMSSNSQPLPLKFSHTN
RTRTTTTNNNRHKIRASSSTDDPSPSSSSATNFVLFSSAALTVTLAVANR
VLYKLALVPMKDYPFFLAQFTTFGYVVVYFSILYIRYRAGIVSDEMLAIP
KLRFLAIGFLEALGVATGMFAAAVLPGPVIPVLSQTFLVWQLMISVLLLG
RRYSINQLVGCLLVASGVVVSITSGSNTGQMLSEVEFFWPALMIVSSAFQ
AAASVIKESVFVDNAIQLKVIIIIIIIIWVLGGGQKSLDIFVVNSFGSGF
QALFVLLFLPLLSNLKGIPFVQLPSYLKSGAGCFLNLGTHKSSKL.
back to top
Expression

Gene expression for aradu.Aradu.DMF7Y has been determined by its associated transcript, Adur48397_comp3_c0_seq3 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.