Description
Gene Model Namearadu.Aradu.DU4CZ
Micro Synteny Viewaradu.Aradu.DU4CZ
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_9DF550
DescriptionHeat shock protein Hsp20 n=2 Tax=Sulfurihydrogenibium RepID=B2V9Z8_SULSY; IPR008978 (HSP20-like chaperone)
Protein domainsG3DSA:2.60.40.790 PF00011 PTHR11527 PTHR11527:SF60 SSF49764
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.DU4CZ.1

Sequences
Gene Model Namearadu.Aradu.DU4CZ
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.DU4CZ.1 sequence

>aradu.Aradu.DU4CZ.1
AAATGTTCACCCAAGAATGCCCCTATCAAAGACAAAAATGGAGGCAATAG
AAGCAAGTGGGGTGACATGTGAGTATGTGACTAATTTGAAGCAGCAATAT
TCTATTCTACTAAAGTTGATAATTTAGGTTAGTAGTGAGGACCATGTGGC
ATCTTTAACTCTTTACACCTTCAAGTTTCAAAGATATTTAGATTCAATGG
GCCCCACATGTTCCTTTGCTCAACTAAAAAATCTTCCACAGTGCTCAATG
ATTGGCTTCTCACTGCTTATAATCTTATTCATCTTCAGATCCACACAGTG
TCACACACTTCATCATATTCATCTTCATCTTGGTTTAGTGCAAAAAAAAT
ATGGAGAGTGAATTGGTGAGGCGCAGAGTTAACTTGATTGCTTCCCATTT
TGCATCAACTGATGACATCTCAGCTACTCATGTTCTCCCTATGAACTGCA
GTGGTAGTTTGAACTCTGTGCTCCGGCGATGCGATAACAAGGTGTATTTC
GCGCGCCAATCATCTGAATCTTATGGTTATTTCATGAGGCAGATTTCAGC
TGAAGAGGGTGCTCCAACTCCTAAAACTTTTGGTTCTGCATCTGATCAGA
GTCCTGCTAACACAAGAGCACCATGTTTTGCTAGACCCGAAAGTACACCT
TGTTTTGCCAGACCCGGAAGAGCACCGTGTTTTGCTAGACCGGCGAGAAC
TGAATCGGATTACTTAAGTTCAGTCGTTCAACCATTGGCTCCAGTGCAGG
GTGGTGAATTTAGTACACTTGAACCTCCTTCATTTTCTAGGCCAAGAAAA
CCGCTACCGCGAGTAGACCAACTACATTCTGAAATTAATGGAACTGAGTG
GTCTCCGAGGATGGATGTCGCGGAATCAAAAGGAAAATATGTTATCACAG
TTGAAGTTCCAGGAGTTAGGATCAATGACATAAGAGTGGAGGTTGATGAT
CAAAAGTTATCTGTCAAAGGTAGACGCTCTACTAGCTACTTGACAATTGC
AGGGTCTCCGAATGCCTCGTTTTCTTCGTATCACAAGCGCGAGATACTAT
ATGGACCATGCGAGGCGGTCTGGCCACTCCCTTCCGGCGTGAACAAGGAT
CATATATCAGCTGAATTCCAGGATGGATTTCTTCAGATAATAATTCCTAA
GATTTGAATGAGCAATAATGTTGATTGCAGCCAAAACATATTTTGGAGCA
TTTGTTTGGTTATGATCATATCATATCATATCATAAATAGATCATAAGAT
AGGCTATGTTGTGCTTTAGAAATGCTTTTATTTCTTCTGTACCAGTTATG
TCTGTCTATGTCTTATTTTATATGCCACTAAACAAAAGAATTTGGCTGAA
CCTTAGTATATACATATTTATGGCTTAATTTTGATTGATCAAGATATTAT
TGCTGATCTTATTTTACATTGTATGTTGATTTATTTGAAGATTTATTACA
GGATATGATGAATGCTTAAAAACCAAAGTTAA
back to top
Protein Sequence

aradu.Aradu.DU4CZ.1 sequence

>aradu.Aradu.DU4CZ.1
MESELVRRRVNLIASHFASTDDISATHVLPMNCSGSLNSVLRRCDNKVYF
ARQSSESYGYFMRQISAEEGAPTPKTFGSASDQSPANTRAPCFARPESTP
CFARPGRAPCFARPARTESDYLSSVVQPLAPVQGGEFSTLEPPSFSRPRK
PLPRVDQLHSEINGTEWSPRMDVAESKGKYVITVEVPGVRINDIRVEVDD
QKLSVKGRRSTSYLTIAGSPNASFSSYHKREILYGPCEAVWPLPSGVNKD
HISAEFQDGFLQIIIPKI.
back to top