Description
Gene Model Namearadu.Aradu.ELE7V
Micro Synteny Viewaradu.Aradu.ELE7V
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_2HC3CL
Descriptionribosomal protein L2 [Glycine max]; IPR008543 (Uncharacterised protein family Ycf2), IPR012340 (Nucleic acid-binding, OB-fold); GO:0005524 (ATP binding), GO:0009507 (chloroplast)
Protein domainsG3DSA:2.40.50.140 PF05695 SSF50249
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.ELE7V.1

Sequences
Gene Model Namearadu.Aradu.ELE7V
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.ELE7V.1 sequence

>aradu.Aradu.ELE7V.1
ATGTATGGATCTATAGGTCTATGTGTCTATATAGATCCTATTCATGGATT
AACGTCATGGATTAACGAAAATGTGCAAAAGTCATCAGATCCGGGATGGG
ATATGGTTCCGAAGGATGAACTGGACAGTTCCAATAAGATTTCATTCTTG
AACAAAAATCTTTCTTATAATTTGGATATGTTATTTAGGAATCAATCTAT
TAGCATAAGTATATATGGTAGAATCGTAACCATAGAATACGAGCCTAATC
GAAATGCATACATCTGTCTCATACACTATGACGTTGATAAGATCCTTCCA
TCTAGCAGCACCTTAGGATGGCATAGCCTTCAAATTAAGGGCGAGGTTCA
AACGAGGAAAGGCTTATGGTGGATACCTAGGCACCCAGAGACGAGGAAGG
GCGTAGTAAGCGACGAAATGCTTCGAGGAGTTGAAAATAAGCTACCCAGA
TCGTTACGCCTTTCGTGCGGGTCGGAAATTCCCTCTGCCCCTACCGTACT
CCAGCTTGGTAGTTTCCACCGCCTGTCCAGGGTTGAGCCCTGGGATTTGA
CGGCGAACTTAAAAAGCCACCTACAGACGCTTTACGCCCAATCATTCCGG
ATAACGCTTGCATCCTCTGTCTTACCGCGGCTGCTGGCACAGAGTTAG
back to top
Protein Sequence

aradu.Aradu.ELE7V.1 sequence

>aradu.Aradu.ELE7V.1
MYGSIGLCVYIDPIHGLTSWINENVQKSSDPGWDMVPKDELDSSNKISFL
NKNLSYNLDMLFRNQSISISIYGRIVTIEYEPNRNAYICLIHYDVDKILP
SSSTLGWHSLQIKGEVQTRKGLWWIPRHPETRKGVVSDEMLRGVENKLPR
SLRLSCGSEIPSAPTVLQLGSFHRLSRVEPWDLTANLKSHLQTLYAQSFR
ITLASSVLPRLLAQS.
back to top