Description
Gene Model Namearadu.Aradu.FG7FZ
Micro Synteny Viewaradu.Aradu.FG7FZ
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_MY3F45
DescriptionRab GTPase activator; IPR000195 (Rab-GTPase-TBC domain); GO:0005097 (Rab GTPase activator activity), GO:0032313 (regulation of Rab GTPase activity)
Protein domainsCoil G3DSA:1.10.8.270 PF00566 PS50086 PTHR22957 PTHR22957:SF51 SM00164 SSF47923
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.FG7FZ.1

Sequences
Gene Model Namearadu.Aradu.FG7FZ
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.FG7FZ.1 sequence

>aradu.Aradu.FG7FZ.1
CCAAATTCAAACTTAAAAGATATGGGCAGTAGAATTGCAGATTTTCTTGA
AGTATGTTGTTGTCCTTACTGAGTAAGCGCTCATTAGAGGTTGATTCCAG
GGATTCTTATGGATTTGCATTGAGGCCTCAATACGCACAAAGATACAGAG
AGTATTCTTCAATCTACAAGGAGGAGGAAGGTGAAAGATCATATAAATGG
AGAAGCTTCCTTGGAGAGGCACCCAACTCAGCAAAACCAAGTTCTCCAGA
GAAAAAACACAAAGAAACATCGGAAGTTGAATGTAATGAGGTAAAAGAAG
AGAGTAGTTCAAATAAAGTATGCAAAGAAGATGATTTAAGCAGTAAGAAT
ATTTCTGAAGGCACTAAAGAGGTTGGTGTAGGGGGTGTTAGTGAAGGAGG
TGACTTAAGTGGCAATAAGTCTTCTGGAGTTAATGAGATAAAAGAAGGCA
CTAGTGCAGGAAGGGTTTGTGAAGGGGGTAATTCAAGTGGCAGAAAGGTT
GTTTTTGATAGCTCAATAGAAAACAGTTCAGAAAAGGATTTGCACTATTC
AGAAGAAAGAAAGACACGTAAAGTTCAACGCTGGGCTGAAATTAGGCCAT
CTCTTAGTGCCATTGAAAAATTGATGAGTTCTCGTTTCAAAAAGGGAAAT
GATGTGAAAGGCGAGATAAGAAATGGTAATAATGACCATCTTCCATATAT
AGAAAAATCTAAACTTGGAGGAGGGGTTTCTGCAACGGATGTTAATAAGT
CAAGTGCTGCGTTAGTGGTTGAAGATTCACTTCAACAATTCTCTCTATGG
AAAGAACTGGAGTTTCTTGTTCAGGGAGGCATCCCAAAGGATCTTAGAGG
AGAGGTTTGGCAAGCCTTTGTAGGTGTAAAGACAAGGCGGGTTAAGAGCT
ATTATGAGGATCTGTTAGCAAAAGAAACTATCAATGCTGAAAGCAATGAG
CAAAATGATACATCCACTGCATCTGGGAAGTGGAGAAAGCAGATTGAGAA
GGACATTACAAGAACTTTCCCAGGACACCCTGCTTTGGATGAACATGGTA
GAAATTCCTTGAGGCGTTTACTCCTAGCATATGCTAGACATAACCCCTCT
GTGGGGTATTGTCAGGCAATGAACTTCTTTGCAGGTTTATTGCTGCTTCT
TATGCCGGAAGAAAATGCCTTTTGGACTTTTGTTGGCATCATTGATGATT
ATTTTGGAGGTTGTTATACAGAGGAAATGATAGAATCCCAGGTGGACCAG
CTTGTCTTTGAAGAATTAATGCGTGAAAGATTTCCAAAACTGGTTAATCA
TCTGGAATACTTGGGAGTGCAAGTTACATGGATATCTGGACCTTGGTTCC
TATCAATATTTGTGAACATGATTCCATGGGAAAGCGTACTTCGAGTTTGG
GATGTGCTTCTATTTGAAGGGAACCGTGTTATGCTATTTCGAACTGCACT
GGCCCTTATGGAACTATATGGTCCTGCATTAGTCACTACAAAGGATGCAG
GTGATGCGATTACTCTATTGCAATCACTTGCTGGTTCAACATTTGACAGC
AGTCAACTTGTCTTAACAGCTTGCATGGGTTTTCTAGCTGTGACAGAGGA
AAAATTACATGAACTAAGAGAAAAGCATAGACCATCTGTATTAGAAGTAG
TAGAAGAAAGGGCAAGGAAAGGAAGACTTTGGAAGGATTCCAAAGGGATT
GCTTCTAAACTATATAGTTTCAAGCATGACCAAGAACCGTTAGTAGAAGA
AAAGAAGGTTAGTAAAGGAGATGATATGGCCGCTAATGAGGAAATACCAC
GATTAGAGTCTCATTCCTCTGATTTGGATGAACTACTTCACAGTCTTAAT
GTTGATTCTGAAGTGGATTCTCTACCGGATCTCCAGGAACAGGTGGTTTG
GTTGAAGGTTGAGTTATGCCGATTGCTGGAGGAGAAAAGAAATGCAATAC
TGAGAGCTGAGGAGCTAGAAACAGCTTTAATGGATATGGTAAAGCAGGAT
AATCGACTGCAATTGAGTGCAAGGATTGAGGAATTGGAGCAGGAAGTAGC
CGAGTTACAACAAGTCCTTGCAGATAAGAAAGAACAGGAAGTTGCCATGA
TGCAGGTCTTAGTGAAGCTAGAGCATGATCAGAAAGATACTGAAGATGCT
CGTAAAAGAGCAGAACAAGAACTTGCAGCTCAAAAATTAGAAGTTCATAT
CCTTCAGGAAAAGTATGAGAAAGCCATGATATCAATTGCTGAGTTGCAAA
AACGGGTGATTGTTGCAGAAAGTATGTTGGAGGCTACCCTTCAATATGAA
TCTGGCCAAAACAAAGCACTTTCTTCACCAAGGGTTGGTGGTCGTCAAAG
TCCACATACAGATAGCAACTCACGTTTTGGTCTACTTTTTGGACGTGGTT
GGCTTGATAAAAACAAGGGAAAGTCTAATGCTGAGGAATCCGGTGAAAGT
TTGTCTTCCAATGCCGCTTTGGGGACTGAATCCAACGACCAAGAAAAGCA
AACATAGTACATGCAGAGCCGCGATGTTTGAGAGCTAGGAGTAGTTAGTT
ACGGCAGTTTCTGGTTTGTGATAGTTGGCTGAAAGAAAGATAAGAAAGAA
GAATCCACTTGTATCACCATCCATTCAAATCCGAGCCTTTCCTTCCGAAT
TTTTTATTACCCATTAAAGTATTAAACCAAACTAGAGATATATGTCAGGG
ATGCTATAGATATGGATAGTTAAAATAGTAATGTAAAGGTATATCTTTTT
TTTCTTTTTTAACGATGTTATCATTTAATTCAAAACAAACTTAACTTTGT
AACTCTTAATGTGGATTCTTTGATTCGGATGAAGTACACATAAT
back to top
Protein Sequence

aradu.Aradu.FG7FZ.1 sequence

>aradu.Aradu.FG7FZ.1
MLLSLLSKRSLEVDSRDSYGFALRPQYAQRYREYSSIYKEEEGERSYKWR
SFLGEAPNSAKPSSPEKKHKETSEVECNEVKEESSSNKVCKEDDLSSKNI
SEGTKEVGVGGVSEGGDLSGNKSSGVNEIKEGTSAGRVCEGGNSSGRKVV
FDSSIENSSEKDLHYSEERKTRKVQRWAEIRPSLSAIEKLMSSRFKKGND
VKGEIRNGNNDHLPYIEKSKLGGGVSATDVNKSSAALVVEDSLQQFSLWK
ELEFLVQGGIPKDLRGEVWQAFVGVKTRRVKSYYEDLLAKETINAESNEQ
NDTSTASGKWRKQIEKDITRTFPGHPALDEHGRNSLRRLLLAYARHNPSV
GYCQAMNFFAGLLLLLMPEENAFWTFVGIIDDYFGGCYTEEMIESQVDQL
VFEELMRERFPKLVNHLEYLGVQVTWISGPWFLSIFVNMIPWESVLRVWD
VLLFEGNRVMLFRTALALMELYGPALVTTKDAGDAITLLQSLAGSTFDSS
QLVLTACMGFLAVTEEKLHELREKHRPSVLEVVEERARKGRLWKDSKGIA
SKLYSFKHDQEPLVEEKKVSKGDDMAANEEIPRLESHSSDLDELLHSLNV
DSEVDSLPDLQEQVVWLKVELCRLLEEKRNAILRAEELETALMDMVKQDN
RLQLSARIEELEQEVAELQQVLADKKEQEVAMMQVLVKLEHDQKDTEDAR
KRAEQELAAQKLEVHILQEKYEKAMISIAELQKRVIVAESMLEATLQYES
GQNKALSSPRVGGRQSPHTDSNSRFGLLFGRGWLDKNKGKSNAEESGESL
SSNAALGTESNDQEKQT.
back to top