Description
Gene Model Namearadu.Aradu.GE5LA
Micro Synteny Viewaradu.Aradu.GE5LA
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_CM6BSQ
DescriptionD-arabinono-1,4-lactone oxidase family protein; IPR007173 (D-arabinono-1,4-lactone oxidase), IPR010030 (Plant-specific FAD-dependent oxidoreductase), IPR016166 (FAD-binding, type 2); GO:0003824 (catalytic activity), GO:0008762 (UDP-N-acetylmuramate dehydrogenase activity), GO:0016020 (membrane), GO:0016491 (oxidoreductase activity), GO:0050660 (flavin adenine dinucleotide binding), GO:0055114 (oxidation-reduction process)
Protein domainsG3DSA:3.30.465.10 PF01565 PF04030 PTHR13878 PTHR13878:SF15 SSF56176 TIGR01677
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.GE5LA.1

Sequences
Gene Model Namearadu.Aradu.GE5LA
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.GE5LA.1 sequence

>aradu.Aradu.GE5LA.1
ACATTCCTTAATTAACCAAATAAAATGATGTTTCTATTCCTATATATTGG
TTACAGAAATTAAACCTCACCGCCAATCACAAATCAAATGGATAGCTTTA
GCTTTACCTTTTTGATTTGGTGCCTTCTTGCTTTCAATCACATACTTCCG
TTAACGATTCAAACCATTGAGGCTCGGATTCCAGAATCTCCACTTCAATG
CAACCAAACATTTTGTATTCTCCACAACAGCTATGGAAAATGGGGTGATC
GAAAAGACTGTTATGCCCTCAACGCAACCTACCCAACAACGGAACAAGAG
CTTCACGTGGCCGTCTCGTTTGCTGTGGAACACAATCTAAAAGCGAAGGT
GGTCACAAAATTCTCACATACCATCCCCAAGCTCGCCTGCCCTGACCAAG
CGGTCCAAAACAGTTTTGTTATTAGTACGGAGAGTTATAATCGTCAAATA
CAGATAGATGTTGCCAATTCTGTTGTCACCGTTGATGCTGGTGTTGGCCT
TCGCCAGTTGATTGACGCCGTTGAAGCCTCTGGGTTTAGTTTGGTGGCCT
CACCTTATTGGGAAGGGGTAACAATTGGAGGACTTATTAGCACAGGGGCA
CATGGGAGTTCTTGGTGGGGGAAAGGTGGTTCTGTTCATGATCATGTTGT
GGGGCTCAGCATCATTGTTCCTGCTTCCAAAGCTGAAGGATATGCCAAGA
TTTTGAGATTGGAAGCACATGATCCATTATTCAATGCTGCCAAAGTATCG
CTCGGTGTCTTGGGTGCTATCTCCAAGGTAACATTAAGAGTGGAACCAAG
GTTCAAAAGAAGCATAACCTACAATTTCACGTCCGATGTTGGTCTTGAAG
ATTTGTACGTAGATCATGCAAATAAATATGAGTTTGCAGACATAACTTGG
TATCCATCACAGCACACTGCTGTTTATAGATATGATTCAAGGGTTCCCTT
AAATACTTCCGGTAATGCAGTCTTTGACTTCATTGGATTTCAAAATAATC
CAACTTCGATCTCCGAAGCAGTTCGAGCTACAGAGAGTTTGTTAGAAAAA
ACAAGAAACACGCATGGGAAATGCTTAACAGCAGCAGCAACATTAGCATT
TAAAAAAGCTACAGCAAATGGTTTAAAGAACAATGGCATTCTTTTCACTG
GCTATCCAGTAATCGGTTACCAAAGCAAAATGCAAACCTCAGGTTCATGC
TTATACTCCCAATCACTCCTCACATCATGTGCTTGGGATCCAAGAATCAA
AGGCTTGTCCTTCTATGAATCCACAGCAATCTTTCCAGCTTCTATTTTCC
GTGATTTCATCTTGGACGTGAAAAAGCTCAGAGACTTAAACCCCGAACAT
TTTTGTGGGGTTGACAACTATAACGGTATTCTTATACGTTATATCAAAGG
GTCGGATGCATATCTAGGTCAATCTGAAGACTCTATAGTAATTGATTTCA
ATTATTATAGAGCCAAAGACGCATTAACTCCGCGATTAAACCAAGATATT
TGGGAAGAATTGGAACAAATGGCGTTTTTTAAGTATGGGGCGAAGCCACA
TTGGGCTAAGAATAGGATCATTGCATTCTTGGGAGTGGATAAGAAGTACC
AAAATTACAACAAGTTTATTGAAGCAAAACAACAATTGGATCCACAAAAT
GTGTTTTCTAGTAATTGGTCTGATGAAATATTGTTTGGGAAGGAATTAGA
GAAGAGTGATGGATGTGCTCTTGAAGGGTTATGCATATGTAGTGAACACA
GACATTGTAGCCCACAAAACAATTATTATTGTAGCCAAGGACTTGTCTAT
AAGGATGCTAGGTACTTTACGCAAAGTTATACCATGCATGGCATTCAAAA
ATATAATCTCTTCAAAGTTTACTTCTTTCGATTCATGGCTTCACTGAAAA
TATAA
back to top
Protein Sequence

aradu.Aradu.GE5LA.1 sequence

>aradu.Aradu.GE5LA.1
MDSFSFTFLIWCLLAFNHILPLTIQTIEARIPESPLQCNQTFCILHNSYG
KWGDRKDCYALNATYPTTEQELHVAVSFAVEHNLKAKVVTKFSHTIPKLA
CPDQAVQNSFVISTESYNRQIQIDVANSVVTVDAGVGLRQLIDAVEASGF
SLVASPYWEGVTIGGLISTGAHGSSWWGKGGSVHDHVVGLSIIVPASKAE
GYAKILRLEAHDPLFNAAKVSLGVLGAISKVTLRVEPRFKRSITYNFTSD
VGLEDLYVDHANKYEFADITWYPSQHTAVYRYDSRVPLNTSGNAVFDFIG
FQNNPTSISEAVRATESLLEKTRNTHGKCLTAAATLAFKKATANGLKNNG
ILFTGYPVIGYQSKMQTSGSCLYSQSLLTSCAWDPRIKGLSFYESTAIFP
ASIFRDFILDVKKLRDLNPEHFCGVDNYNGILIRYIKGSDAYLGQSEDSI
VIDFNYYRAKDALTPRLNQDIWEELEQMAFFKYGAKPHWAKNRIIAFLGV
DKKYQNYNKFIEAKQQLDPQNVFSSNWSDEILFGKELEKSDGCALEGLCI
CSEHRHCSPQNNYYCSQGLVYKDARYFTQSYTMHGIQKYNLFKVYFFRFM
ASLKI.
back to top
Expression

Gene expression for aradu.Aradu.GE5LA has been determined by its associated transcript, Adur12299_comp0_c0_seq2 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.