Description
Gene Model Namearadu.Aradu.HRC5S
Micro Synteny Viewaradu.Aradu.HRC5S
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_67TP5Q
Descriptionhypothetical protein
Protein domains
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.HRC5S.1

Sequences
Gene Model Namearadu.Aradu.HRC5S
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.HRC5S.1 sequence

>aradu.Aradu.HRC5S.1
ATGGCACAAGAAGCAGCATTGATGGCCATGGAGTCTCAGGTGAACAACGC
CAGCTCCACAAAAAAGCGATCAGTGAGGAATGACAAGCTTCTCCTCGACG
ATTACATCCATTTCCTTCGCTCTCGCCATTCCCTCGACCTCACCATATCA
TTCGCATTCACGGCTTCAAGAAGATACACCACGCTCCCAAGAAACTTCTG
TGTGATTTTTCCACAGAAGGTGTTGGTGGACGCGGTGAACTCGCTCGATC
TCGTGAACCTATCGCGCTCCACGCTCCACAGTAGCGTCGTCTCAGCGTTC
GCGGTTCTTACGGTGGAGGACGCCATTGCCGATCTCAACGAGCTCAACTG
GCAAGAGTGCTGCGTCACTTCGTTGGAGAAACTCTGCAGCAGCAACAACA
ACCACAAATTCCTCTTTCCTCCTTCATCCTCCGATCCTCACCATAGCCGC
CTCCAGTTCGCGAACCACTTGCAGGTTGCGCCGAAAAGGAAGATCAGTGG
CAGCGGTGACGGCGACGAAACGTGCTGCGGCGGCAGAGAACTCATCTCCG
AGGCTTTTCGCAGCGGCATGCGACCGGCGAAGATGGTACCTAGGCGTAAG
AGGAGCGGCGCTCATGCTCCTTCTGGTGCTGTATGA
back to top
Protein Sequence

aradu.Aradu.HRC5S.1 sequence

>aradu.Aradu.HRC5S.1
MAQEAALMAMESQVNNASSTKKRSVRNDKLLLDDYIHFLRSRHSLDLTIS
FAFTASRRYTTLPRNFCVIFPQKVLVDAVNSLDLVNLSRSTLHSSVVSAF
AVLTVEDAIADLNELNWQECCVTSLEKLCSSNNNHKFLFPPSSSDPHHSR
LQFANHLQVAPKRKISGSGDGDETCCGGRELISEAFRSGMRPAKMVPRRK
RSGAHAPSGAV.
back to top