Description
Gene Model Namearadu.Aradu.IM707
Micro Synteny Viewaradu.Aradu.IM707
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_1Z0SF4
DescriptionProtein kinase family protein; IPR011009 (Protein kinase-like domain), IPR013210 (Leucine-rich repeat-containing N-terminal, type 2), IPR013320 (Concanavalin A-like lectin/glucanase, subgroup); GO:0004672 (protein kinase activity), GO:0006468 (protein phosphorylation)
Protein domainsG3DSA:1.10.510.10 G3DSA:2.60.120.200 G3DSA:3.30.200.20 G3DSA:3.80.10.10 PF07714 PF08263 PTHR24420 SSF52058 SSF56112
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.IM707.1

Sequences
Gene Model Namearadu.Aradu.IM707
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.IM707.1 sequence

>aradu.Aradu.IM707.1
TTCTAGAAATTCTCTATCTTTTGTGGAGTTTTCTCATCGTGGTTGAGATT
TGTTTCAGCTCTGCATGCTCCTGAGGATAATTGAGACGAAAGCATTGAGA
TTATGTCTTTGTTGAGCAAAAGCTTGTAACAAAGAGATAGGATTACACAG
AATGAGGGACCCTGATTGGATCAGAGCTTCCATTATACAAAACCTTTGCC
AAGTTAATTGAGTTTTTCTTCTTCTTCGTCCGAATACATTCTCTTTGTAC
AGCAAAATCCTAGAAATTGTGTACATTGTATTGCATAGAATCCTGGCTAT
CAAGGATTATAGATACCGTCTCAGTCACTCTGGCATTGGTTTCCCATAGA
AATGGGAATGAGATGGAACATATTTAGATTTTGGCTCAGAATTTATGTTT
GCTTAATTGCTCTTTGGGGAATCCAAGAGTGTTGCTCTCTTAATGACGAA
GGACGTAATGCAATCATTATATATATATTGAAGCATGTTTTCATTTACAT
GGAAAGTGCAGGAATAGCTTTGTTGGAGTTCCGGGCAAGAATAACTTCTG
ATCCTTATTTTGCTTTGGCAAATTGGAATCCAAATGATTGTGATCCCTGC
AAGTGGTTTGGTGTTCGTTGTGTTGATGGTAAAGTGCAAACATTGGACCT
TAAAGGACTATCTTTGGAGGGGATATTGGCTCCTGAGCTTGGAAAGCTTA
GTCACTTAAAATCTCTCATTTTGCGCAAGAATAACTTTTCGGGCGCTATT
CCGGAAGAACTTGGAGATCTAGCCAAGCTGGAGCTATTGGATTTAAGGGA
AAATAACTTGAGTGGAATTATCCCAACAGAAATTGTCAGGTTGTTATTGC
TAAAACACTTGTTGCTTTGTAACAATAACAATGAATGTGGTGGTTCTCAA
TATGACAATGATGGTGGGTGTTCTCAATATGACGATGAAGGTGGTGGTTC
TCAATATGATGGAGAGTTCAGATTTAAATCACTACTTGTTGCCAATTTTT
CAGAACCTCTAACAACATTGGTTGCATGCATCAATAGAAAGTTTGGACAC
TGTGTGTGGAAGAGCAACTTGAAGGAATGGAACGAACCAGATTCAACGGT
TAACCAAATTAAAGTAACAATTGCAAACTACCTCAGTGCTGTTGTGCTGC
AACTGTTTAAGCTAGGAAAGCATACCCTAGATGGAAATGAAGAGAATTGT
TGCGACCTTTTAACCGATTCTAATGAGATAGACAACGTTGAAAACGTACC
GGATCTAGACAATTCGGCACGTAGGAAGCTACTTGATCAGTCCAGTAACC
TTGCAGCCGCGCCATATAGTGGCGAGGCTAATATAGGGATCAGCACTGAT
CCAGTTACACAAAGCAGTGGGGGGTTCCCAGCTGTGCCAGCTGCAAAAGA
GGAGCAGAATCAAGCACCTCCACCTCCACAGCTGCAGCCACCTTCTGATC
CTAAAAGTGATGCTTCTTCTAGTGCAAATAAACCAAGTCAGCAACCACAT
TCAGATAATGGTTCCTCTGGGAATTGGAGGAAGTATCTTCTTATTATTGC
ACTTGTGATTGTGTTGGTCATTGTTATCATAATCATTATTTGCATTTGGC
GTAAAAGAGCAGTGAAGGTAATAAAACCATGGAAGACAGGAATAAGTGGA
CAGTTGCAAAGGGCATTCATAACAGGAGTCCCGAAGTTGAATAGAGATGA
ACTAGAGACAGCTTGTGAGGATTTCAGCAATATTGTTAGTACTAAGTATG
ATGAGTGCATCATATACAAAGGAACCCTGTCCAGTGGAGTTGAGATCGCT
GTCGTTTCTACTGTGATTAAATCTGCCCAAGATTGGTCAAAGAACACAGA
GTTGAACTACCGGAGAAAGATTGATTCTCTGTCCCGAGTAAACCACAAGA
ACTTTGTTAACCTTATTGGCTACTGTGAGGAAGAAGAACCATTCACAAGG
ATGATGGTGTTGGAGTATGCTCCGAATGGATGCCTATTTGAGCATCTGCA
TGTTAGGGAAGTTGAACGTCTCAAATGGAGTGAAAGGATGAGGATAATCA
TGGGCACTGCCTATTGTCTTCAATACATGCATCATGACCTGAACCCACCA
GTAACACATACTGACCTTAATGCACATTCGATCTTTTTGACAGATGACTT
CGCCGCTAAGATTGCTCAGACCACATTCCGGAATATCGTAACACGCTCTG
AGGCAAACAAAGAGAGGAGAAAGAAATCTGAGTTGCCACCCCATGATGAT
CCTGAAACCAATGTCTATTGCTTTGGGGTGCTGTTGCTAGAGATCGTTTC
TGGGAGATTACCTCACTCTGTAGAACAAGGCAGCCTTGTTGATTGGGCTG
CTGGGTACTTGAACGACAAGGGAAGCTTCAAATATCTGATTGATCCAACT
CTGCAATCTGTCAAAGACAATGAACTTGATGTCATATGTGAGGTGGTCAA
AGAATGTATCCAACCTGATCCAAGGTTAAGACCAACAATGAGAGAAATCG
CAATCAAATTAAGGGAAGCTCTTAGAATATCACCTGAGCAAGCAGTTCCA
AGATTGTCTCCACTTTGGTGGGCTGAATTGGAGATCTTGTCAGTGGAAGC
CACTTAATTAAGTTTTATCTGACTCTCTTCTATTTGGTTTTTGTTCATAG
TCAAGTGTCTCTTTAGCCTTTTATCAAGCAGCAAGAGTGCAAGTTAGGAT
ATTTGCTAGTCAAGTTCTTTTTGCTCCGTTCTCTTTGGTCTTGATCCTTA
AGACCTTAGCCACTCATGTCTCAACGGAAGTGTGTTTGTGTTGTTGATCA
ACTATGGGATCTAAAAATTTTAATTTAGTATTGGGAATTTGGGATGTTGA
TCCCCACTCCCTATGCAACTTTTGAATAGGTGAGTATAGCTCTATAGATT
ATTGAATTGTTCATGTAATGAAATGAAACTAGTACTTTCTTGCTCGCTTG
ATCTGTGAT
back to top
Protein Sequence

aradu.Aradu.IM707.1 sequence

>aradu.Aradu.IM707.1
MGMRWNIFRFWLRIYVCLIALWGIQECCSLNDEGRNAIIIYILKHVFIYM
ESAGIALLEFRARITSDPYFALANWNPNDCDPCKWFGVRCVDGKVQTLDL
KGLSLEGILAPELGKLSHLKSLILRKNNFSGAIPEELGDLAKLELLDLRE
NNLSGIIPTEIVRLLLLKHLLLCNNNNECGGSQYDNDGGCSQYDDEGGGS
QYDGEFRFKSLLVANFSEPLTTLVACINRKFGHCVWKSNLKEWNEPDSTV
NQIKVTIANYLSAVVLQLFKLGKHTLDGNEENCCDLLTDSNEIDNVENVP
DLDNSARRKLLDQSSNLAAAPYSGEANIGISTDPVTQSSGGFPAVPAAKE
EQNQAPPPPQLQPPSDPKSDASSSANKPSQQPHSDNGSSGNWRKYLLIIA
LVIVLVIVIIIIICIWRKRAVKVIKPWKTGISGQLQRAFITGVPKLNRDE
LETACEDFSNIVSTKYDECIIYKGTLSSGVEIAVVSTVIKSAQDWSKNTE
LNYRRKIDSLSRVNHKNFVNLIGYCEEEEPFTRMMVLEYAPNGCLFEHLH
VREVERLKWSERMRIIMGTAYCLQYMHHDLNPPVTHTDLNAHSIFLTDDF
AAKIAQTTFRNIVTRSEANKERRKKSELPPHDDPETNVYCFGVLLLEIVS
GRLPHSVEQGSLVDWAAGYLNDKGSFKYLIDPTLQSVKDNELDVICEVVK
ECIQPDPRLRPTMREIAIKLREALRISPEQAVPRLSPLWWAELEILSVEA
T.
back to top