Description
Gene Model Namearadu.Aradu.ITC2N
Micro Synteny Viewaradu.Aradu.ITC2N
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_2GMRPG
DescriptionTCP-1/cpn60 chaperonin family protein; IPR002423 (Chaperonin Cpn60/TCP-1), IPR027409 (GroEL-like apical domain), IPR027410 (TCP-1-like chaperonin intermediate domain), IPR027413 (GroEL-like equatorial domain); GO:0005524 (ATP binding), GO:0005737 (cytoplasm), GO:0042026 (protein refolding), GO:0044267 (cellular protein metabolic process)
Protein domainsCoil G3DSA:1.10.560.10 G3DSA:3.30.260.10 G3DSA:3.50.7.10 PF00118 PR00298 PTHR11353 PTHR11353:SF8 SSF48592 SSF52029 SSF54849 TIGR02348
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.ITC2N.1

Sequences
Gene Model Namearadu.Aradu.ITC2N
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.ITC2N.1 sequence

>aradu.Aradu.ITC2N.1
CTTCAGGATGAAATCTCTCACCACTAATTTATCTCCTGTTCCGTTGCAAA
CAACGACAAAAATAAAAAACCTAATCCCTCACTCGCTCAGTTGCTCATTC
TCTCTCAGCTCAGCCACTTCGCCAAAAAGAGAAAGCAGTGTAGCTCTCAG
CGTTATCCATATACCCCACTCAATCTTTCTTAAACCTAATTTGAGTTATT
GTCCAATTTTTGGGGAGGCAATGGCGTCGTCAACATTCTCAGCAGTCTCC
TCTACCGGCTCACTTGTCGCACCGCCGCACAAATTCTCTTCCTCTGCCGC
CATTTCTTCCCTTCCCTTTGCCGCCGGCAAAGCGCGACGGAGCGGCGTTG
CTATCGGTAGGAGGAATCGGTGTCCCAAGGTCTCTGCTATGGCCAAGGAG
TTGCATTTCAACAAGGATGGCTCAGCTATCAAGAAGCTCCAGAGTGGTGT
GAACAAGCTGGCGGATTTGGTGGGGGTTACGCTTGGTCCTAAAGGAAGGA
ATGTTGTTTTGGAAAGCAAGTATGGCTCGCCTAAGATTGTCAATGATGGT
GTTACTGTTGCCAAAGAGGTTGAGTTGGAGGACCCAGTTGAGAATATTGG
AGCCAAATTGGTGAGACAGGCAGCTTCCAAGACAAACGACTTAGCTGGTG
ATGGAACAACCACATCTGTTGTTCTTGCTCAGGGTCTCATTACTGAAGGA
GTCAAGGTTGTTGCAGCTGGTGCAAACCCTGTGCTCATCACCCGTGGCAT
TGAGAAGACAACAAAAGCACTTGTATCTGAACTTAAAAAGATGTCAAAGG
AGGTTGAAGATGGTGAGTTGGCAGATGTTGCTGCTGTCAGTGCAGGAAAC
AACTATGAAGTCGGGAATATGATAGCTGAAGCAATGAGCAAGGTTGGCAG
AAAGGGTGTTGTGACACTTGAGGAGCAGATAACAACCTCTATGTTGTTGA
GGGGATGCAATTTGATCGTGGCTACATCTCACCATACTTTGTTACTGATA
GTGAGAAAATGGCTGTTGAATATGAGAATTGCAAGGTTTGACATTTGTTT
TGTCCGGCAATTGCTGTTGGTTGATAAGAAGATAACCAATGCAAGGGATC
TAATTAACATTCTAGAGGATGCAATTAGAAGTGGATTTCCTATTTTGATT
ATTGCAGAGGATATTGAACAAGAACCTCTAGCAACTCTTGTGGTGAACAA
ACTTAGAGGATCACTGAAGATTGCGGCACTGAAGGCCCCAGGATTCGGAG
AACGCAAGAGCCAGTACCTTGATGATATTGCCATCTTAACTGGAGGTACT
GTAATCAGGGAGGAGGTTGGCCTTACTCTAGACAAAGCGGGGAAAGAGGT
TTTGGGGCAGGCCTCCAAGGTGGTACTCACCAAGGACACAACCACAATTG
TTGGTGATGGAAGTACCCAGGAAGCAGTGACCAAGAGAGTTGCACAAATT
AAGAACCAAATTGAGGCTGCAGAGCAAGAGTATGAAAAGGAGAAGCTTAA
TGAAAGAATAGCGAAATTGTCTGGTGGTGTTGCTGTTATACAGGTTGGAG
CACAAACTGAGACAGAGCTCAAAGAAAAGAAGTTGAGAGTAGAAGATGCT
CTTAATGCTACAAAGGCAGCTGTTGAGGAAGGTATTGTAGTTGGTGGTGG
ATGCACTCTATTGAGACTTGCTTCAAAAGTGGATGCTATCAAAGAGAGCC
TTGACAATGATGAAGAGAAAGTTGGAGCAGATATTGTGAAAAGAGCTCTT
AGTTACCCTCTGAAATTAATTGCCAAGAATGCTGGTGTAAATGGCAGTGT
TGTCAGTGAGAAGGTTCTTTCCAGCGACAATCATAGATATGGATATAATG
CTGCCACTGGGAAATATGAAGATTTAATGGCTGCTGGAATCATTGATCCA
ACAAAGGTGGTGAGATGTTGCCTAGAGCATGCAGCCTCTGTTGCTAAAAC
TTTCCTGATGTCAGACTGTGTGGTTGTTGAGATCAAGGAACCCGAGCCTG
TACCTGCCGGTAACCCCATGGACAATTCAGGATATGGTATGTAGAGCACT
AGAGCAGTAGAGGAGCGGCTACTTTAATCATGGAGCAGTATTTTTTTTCT
CCTTTTAGATGAAATACATAATCTGGAGGTTATTTTGTTTGTAGCAACAA
GTCTTAAATCTGTGCGGATAGTGTGGTTAATTAGATCCAACGATGTCTTT
TATTTTTAAGTTTAATAAAAATATAAAAATTTTGCTGTTCATTTCCAGCC
CCATTTTTGTTATAAGAGTATTTCAGTCCTAATACGATCGTTACTACTCG
CAACTCCCAAGTTGGATTGTGTGCAGTTTTTACTTTTTGACTATTCATAC
CTGGTATTTTATTAT
back to top
Protein Sequence

aradu.Aradu.ITC2N.1 sequence

>aradu.Aradu.ITC2N.1
MKSLTTNLSPVPLQTTTKIKNLIPHSLSCSFSLSSATSPKRESSVALSVI
HIPHSIFLKPNLSYCPIFGEAMASSTFSAVSSTGSLVAPPHKFSSSAAIS
SLPFAAGKARRSGVAIGRRNRCPKVSAMAKELHFNKDGSAIKKLQSGVNK
LADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAKEVELEDPVENIGAK
LVRQAASKTNDLAGDGTTTSVVLAQGLITEGVKVVAAGANPVLITRGIEK
TTKALVSELKKMSKEVEDGELADVAAVSAGNNYEVGNMIAEAMSKVGRKG
VVTLEEQITTSMLLRGCNLIVATSHHTLLLIVRKWLLNMRIARFDICFVR
QLLLVDKKITNARDLINILEDAIRSGFPILIIAEDIEQEPLATLVVNKLR
GSLKIAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLTLDKAGKEVLG
QASKVVLTKDTTTIVGDGSTQEAVTKRVAQIKNQIEAAEQEYEKEKLNER
IAKLSGGVAVIQVGAQTETELKEKKLRVEDALNATKAAVEEGIVVGGGCT
LLRLASKVDAIKESLDNDEEKVGADIVKRALSYPLKLIAKNAGVNGSVVS
EKVLSSDNHRYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFL
MSDCVVVEIKEPEPVPAGNPMDNSGYGM.
back to top
Expression

Gene expression for aradu.Aradu.ITC2N has been determined by its associated transcript, Adur24131_comp1_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.