Description
Gene Model Namearadu.Aradu.J6P55
Micro Synteny Viewaradu.Aradu.J6P55
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_1GQHGD
Description3-ketoacyl-CoA synthase 11; IPR012392 (Very-long-chain 3-ketoacyl-CoA synthase), IPR016039 (Thiolase-like); GO:0003824 (catalytic activity), GO:0006633 (fatty acid biosynthetic process), GO:0008152 (metabolic process), GO:0008610 (lipid biosynthetic process), GO:0016020 (membrane)
Protein domainsG3DSA:3.40.47.10 PF08392 PF08541 PIRSF036417 PTHR31561 SSF53901
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.J6P55.1

Sequences
Gene Model Namearadu.Aradu.J6P55
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.J6P55.1 sequence

>aradu.Aradu.J6P55.1
ATGTGCTTTGGTAGAATTCTTTGTAAAGGGATCTTTTGCCAGGACTGGAC
TATAAAGATGTTCTATGCTCAAAAGATGGTGAAAATGGCTGATGCAAAAG
CAGATGCACCCTTGGTGCCATCATCATCTAGGAACCTTCCTGATTTCAAG
AAATCCGTTAGATTGAAGTATGTCAAGCTTGGTTACCATTACCTAATCTC
CCATGGAATGTACTTATTCCTTTCCCCACTTGTGGTTCTGATTTCTGCAC
AGCTCTCCACTTTCTCCTTACAAGACCTCCATGATCTGTGGCAGCATCTG
CAATACAACTTGATTTCTGTTATTCTTTGCTCGACCCTCCTTGTGTTCTT
GTCCACCCTTTACTTTTTGACTCGCCCTCGACCTGTGTACCTTGTCAATT
TTGCCTGCTACAAGCCTGAAGAATCCCGGAAATGCACGAAGAGAGTATTT
ATGGAGCACTCCCGGTTGGCTGGCACCTTCACTGAGGAAAATCTTGCCTT
CCAGCAGAAGATCCTTGAGAGATCTGGTCTGGGAGAGAACACTTACCTTC
CGGAAGCTGTTCTCAACATTCCTCCCAATCCTACGATGAAAGAAGCTAGA
AAAGAAGCTGAGACTGTGATGTTTGGAGCCATTGATGAGCTGTTTGCTAA
GACCTCTGTAAATCCTAAAGACATTGGGATTCTAATTGTGAATTGCAGCC
TGTTCAACCCAACTCCATCGCTTTCAGCAATGGTTGTCAATCACTACAAG
CTTCGAGGGAACATAAGAAGCTACAACTTAGGTGGGATGGGATGCAGTGC
AGGGCTAATCTCAATTGATCTTGCTAAAGATCTTCTCCAGGCCCATCCTA
ATTCCTATGCACTGATCATTAGCATGGAGAATATCACACTGAATTGGTAT
TTTGGAAATGATCGATCAAAGCTTGTTTCTAATTGCCTGTTTCGTATGGG
AGGAGCTGCAGTTCTGCTGTCGAACAAAAGCTCCGACAGAAGACGATCCA
AATACCGATTAGTCACCACTGTTCGCACTAACAAGGGTGCTGATGATAAG
TGCTTCAGCTGTGTCACCCAAGAAGAAGATGAAGCAGGCAAGATTGGTGT
TACTTTGTCAAAGGATCTGATGGCAGTTGCCGGGGACGCGTTAAAAACCA
ATATCACTACATTGGGGCCTCTTGTACTTCCTATGTCCGAACAGCTTCTA
TTCTTTGCCACATTAGTTGGAAAGAAACTCCTGAAGATGAAGATCAAACC
TTATATCCCTGATTTCAAGCTAGCTTTCGAACATTTCTGCATCCATGCTG
GAGGTAGGGCTGTTTTGGATGAACTGGAGAAGAACCTGCAGCTATCTCCT
TGGCATATGGAGCCATCGAGGATGACACTTTATCGATTTGGAAACACCTC
TAGCAGTTCACTTTGGTATGAACTGGCATACACAGAGGCCAAAGGAAGGA
TTAGGAAGGGAGATAGAACATGGCAGATTGCATTTGGCTCAGGATTCAAG
TGCAACAGTGCAGTATGGAAGGCTCTCAAGACCATCAACCCTGCTAAGGA
GAAGAACCCTTGGATGGATGAGATACACAAATTTCCAGTGGAAGTTCCAA
GGGTATCTGCCATCTGAAGGATGGAATTTTTAAATGTTGTGTATCACCAT
TAGGTGTTAGTTGTAAGTTATTTTTCCTTCTGATCTACTGTAAAACTTGT
GTTTTCAAAGTCATGTTCAGATTTAGGAGTTCTATTTTGCTTTGGGGCAT
GTTAAATCTAATTGGTGCTTGAGCTTTGATTACTGTGACTTCTGACATCT
GAGGACTATATCTGTGATGGGTCTAGACCGTGGGGGTGAAATGCAATTCC
AAACCATGGTTTCTCTTACAAGATTGGAATTAACGTTTTCTATGGTTGAG
TTGTTCTAAGTTGATGTGTTTT
back to top
Protein Sequence

aradu.Aradu.J6P55.1 sequence

>aradu.Aradu.J6P55.1
MCFGRILCKGIFCQDWTIKMFYAQKMVKMADAKADAPLVPSSSRNLPDFK
KSVRLKYVKLGYHYLISHGMYLFLSPLVVLISAQLSTFSLQDLHDLWQHL
QYNLISVILCSTLLVFLSTLYFLTRPRPVYLVNFACYKPEESRKCTKRVF
MEHSRLAGTFTEENLAFQQKILERSGLGENTYLPEAVLNIPPNPTMKEAR
KEAETVMFGAIDELFAKTSVNPKDIGILIVNCSLFNPTPSLSAMVVNHYK
LRGNIRSYNLGGMGCSAGLISIDLAKDLLQAHPNSYALIISMENITLNWY
FGNDRSKLVSNCLFRMGGAAVLLSNKSSDRRRSKYRLVTTVRTNKGADDK
CFSCVTQEEDEAGKIGVTLSKDLMAVAGDALKTNITTLGPLVLPMSEQLL
FFATLVGKKLLKMKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSP
WHMEPSRMTLYRFGNTSSSSLWYELAYTEAKGRIRKGDRTWQIAFGSGFK
CNSAVWKALKTINPAKEKNPWMDEIHKFPVEVPRVSAI.
back to top
Expression

Gene expression for aradu.Aradu.J6P55 has been determined by its associated transcript, Adur35887_comp0_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.