Description
Gene Model Namearadu.Aradu.JG7J4
Micro Synteny Viewaradu.Aradu.JG7J4
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_1CRXZ1
Descriptionrac-like GTP-binding protein 7-like [Glycine max]; IPR001806 (Small GTPase superfamily), IPR002939 (Chaperone DnaJ, C-terminal), IPR027417 (P-loop containing nucleoside triphosphate hydrolase); GO:0005525 (GTP binding), GO:0005622 (intracellular), GO:0006457 (protein folding), GO:0007264 (small GTPase mediated signal transduction), GO:0015031 (protein transport), GO:0051082 (unfolded protein binding)
Protein domainsG3DSA:2.60.260.20 G3DSA:3.40.50.300 PF00071 PF01556 PR00449 PTHR24072 PTHR24072:SF103 SM00174 SM00175 SSF49493 SSF52540
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.JG7J4.1

Sequences
Gene Model Namearadu.Aradu.JG7J4
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.JG7J4.1 sequence

>aradu.Aradu.JG7J4.1
TGTGGGAGTTCTAGTGCAAGTGGGGTTTTTCCTTTTTTCTGGGATTTTGG
ACTCAAGTACCAGTGTGAAATGGGACGGCAAATATGATCCAAAATTTTCA
GGCAGCTGATGTATTCCTGCTAGCATTCTCTCTCATAAGCAGGGCTAGCT
ATGAAAATGTTGCCAAGAAATTGAGGCATTATGCTCCTGGTGTTCCAATT
ATTCTTGTTGGAACAAAACTTGATCTTTGGGATGATAAGCAGTTTTTTCA
AGATCATCCTGGTGCAGTGCCTATCACCACAGTGCAGGGTGAGGAACTGA
GAAAACTTATCGGTGCTCCAGTTTACATCGAATGTAGTTCAAAAACACAG
CAGAATGTGAAGGCTGTTTTTGATGCGGCCATCAAAGTAGTTCTCCAGCC
TCCAAAGCAGAAGAAAAAGAAGAGAAAGGGTCAAAAAACCTGTTCCATAT
TCATAACACATGATGGTGTTGGTGTTCCGGAAACATTACTGAACCAAATG
TTCGGACGAGAGGGACAAGAATCCGAGGAGGGTATTAGTCTGCTCATCAG
CAGAAAGTTGCTGAAGCTGATAGAAGGCAAGGGTGATGAGAAACCTGGAT
ACCTCCCTGCTGATATAGTGTTCATAATTGAAGAAAAGAAACACAATTTG
TTTAGAAGAGAAGGCAAGGGTGATGAGAAACCTGGATACCTCCCTGCTGA
TATAGTGTTCATAATTGAAGAAAAGAAACACAATTTGTTTAGAAGAGAAG
GCAATAATGACTTGGAAATATGTATTGAGATTCCTCTAGTAGATGCACTC
ACAGGGTGCTCTTTACCAATTCCTATATTAGGAGGGGAGAACTTGACTTT
GTCATTTGAGAATACTGTTGTATACCTTGGATATGTAAAGGTTATTGAAG
GTCAAGGCATGCCAACCCTTAAAAACGATGGGAAAAGAGGTGACCTCCAT
GTCAAGTTTCTAGTTGACTTCCCCAAAGAATTGAGTGATGAACAATGGCA
AGAAGCTTTTAGAATCCTAGAAAATTGTTGTTAA
back to top
Protein Sequence

aradu.Aradu.JG7J4.1 sequence

>aradu.Aradu.JG7J4.1
MIQNFQAADVFLLAFSLISRASYENVAKKLRHYAPGVPIILVGTKLDLWD
DKQFFQDHPGAVPITTVQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAI
KVVLQPPKQKKKKRKGQKTCSIFITHDGVGVPETLLNQMFGREGQESEEG
ISLLISRKLLKLIEGKGDEKPGYLPADIVFIIEEKKHNLFRREGKGDEKP
GYLPADIVFIIEEKKHNLFRREGNNDLEICIEIPLVDALTGCSLPIPILG
GENLTLSFENTVVYLGYVKVIEGQGMPTLKNDGKRGDLHVKFLVDFPKEL
SDEQWQEAFRILENCC.
back to top