Description
Gene Model Namearadu.Aradu.K2GG8
Micro Synteny Viewaradu.Aradu.K2GG8
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_B3DJBH
Descriptionpaired amphipathic helix protein Sin3-like 4-like isoform X2 [Glycine max]; IPR003822 (Paired amphipathic helix); GO:0005634 (nucleus)
Protein domainsG3DSA:1.20.1160.11 PF02671 SSF47762
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.K2GG8.1

Sequences
Gene Model Namearadu.Aradu.K2GG8
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.K2GG8.1 sequence

>aradu.Aradu.K2GG8.1
ATCTAGATAATGCAGTTGATAGTTGAGTAAATTAAACAAATGAGAGAAAT
CAGAATAACCATGGACTGCAACCTCTATCTCCTGCAAGTTATGGTAGCTC
CATAGAGGGTTAATAATGAAGAAGGAACGTGCACCACGTCCGGGTGTAGT
ACGGCCAAGATTTAAACCCAATACACGTCCATACAACAAAAGCAAGCTTG
ATGCGGTTATACAACGCCTTAAACTTTTCAGAAACATCAAGGCCCGATTC
AAATACAATTTGGATTTGGATATTTACAGCTCGCTTCTAAACAAAGTATT
TAAGTACAGGACCGGAAGAAAGTCTATCACCCAACTGAGCTCAGATGCTG
CTATACTTATGCGAGGCCATCCAGATCTTATTGACCAGTTTAACAAATGG
ATTCCCCGTACTCGTCAAGATTCATGTACGTTACTCTCGCACCACTTGGC
AGCAACACATTTGGAGAACCGTGATCTACAGGATGAGGGCGATGATGAAT
GTATAAAATTATCCAATATATATTGCTCGTCGACTAAGCTTGGTGGATGT
ACAGGCCCCTATAAAGTTTGGAAGATTTGGAAAAAGATCAAGGATCGGTT
TAAGTGCGATATGGAGATTTGTGAGTCGCTAAAGGATAAGGTGGACAAGT
ACAAAGATGGAAGAAAGTCTATCATCCAACTAAGTTCCGACGTTGCTACA
CTTTTGCGGGGCCATCCCGATCTTATTGAGGAATTTCGCGAATGGATTCC
CATCACTCCGAATGAGGGATCCGATGAAGTATCTAGCGATACTAGCTTTA
GTACCACTGATACTGACGCCGATATATACAATGATACATCTTCAGATGCC
ATGGATTAATCTATCAAAATACACTTTTATGAATAATGCTCTTGCTATTT
TTATATTTAAATTGATTATGGATTTAACAGACAATAATGAACATGTTTTT
TTGGTATATTTTAAGTGACTTGTTTCT
back to top
Protein Sequence

aradu.Aradu.K2GG8.1 sequence

>aradu.Aradu.K2GG8.1
MKKERAPRPGVVRPRFKPNTRPYNKSKLDAVIQRLKLFRNIKARFKYNLD
LDIYSSLLNKVFKYRTGRKSITQLSSDAAILMRGHPDLIDQFNKWIPRTR
QDSCTLLSHHLAATHLENRDLQDEGDDECIKLSNIYCSSTKLGGCTGPYK
VWKIWKKIKDRFKCDMEICESLKDKVDKYKDGRKSIIQLSSDVATLLRGH
PDLIEEFREWIPITPNEGSDEVSSDTSFSTTDTDADIYNDTSSDAMD.
back to top