Description
Gene Model Namearadu.Aradu.K68B1
Micro Synteny Viewaradu.Aradu.K68B1
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_5N8VZZ
Descriptionuncharacterized protein LOC100799189 isoform X4 [Glycine max]
Protein domains
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.K68B1.1

Sequences
Gene Model Namearadu.Aradu.K68B1
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.K68B1.1 sequence

>aradu.Aradu.K68B1.1
TAACTTTAGGGAATGGAAGATATTTTTTTGTTATTCAAGTTTGTGGTCCA
AATTTTTTGAATGAGGGAAGCATGGGACTAAGAAACAGACAACTTATGCA
TAAAGGGAAGTTGATGTCATCATTTTGTAGTATTAGGGCTCAATGCCATT
ATTATAGTTTAGCAGTACATATATACACACATTCCCCCACACCAACATAG
CTATTTTCAGCATAAACAATATGATGTTTCCATTGATCATTTCAGGTAAC
ATCAAATTGATAACTGATATATGAAGGTTGAATGATAAACATACATGAAC
ATCTGAACACAAGTTTCCACCAAAGTATAGTTATTAGTTAATACTGCAGA
AGCTTAATTAGCAGTTAGATATCCAATAATGGAGAAGAAGCTCATTAGGC
CATGTGACAGAGAATACATGAGGATGGCCATGCTAAAACATGAACAAACT
TTCAAACAACAGGTGTATGAACTTCACCGTTTGTATAGGATTCAGCAGGC
ACTGATGAAAAACATGGAAGGCAGCAGCAGCAGAATCAGTGAAATTGAAG
AGTCAGAGATTGAGTTGACTCTAGGGCCTTCAAGTCACTACAACCGTAAG
AAAGTTGTTGAGGCATCACCTCTAACTTCAGATTCAGGTCAAAGCTTTTC
TTCTTCTTCTGGTTCTGGTTCTGGATCCTGTTTCATACACAACAACACAA
GTTTCAAGACCCACCAATATCATAGCAGCCATAGAGAAGAATTAGGTGGA
GGCATTATAGGCCTTGTCCAAGTGCCACATTCAAGTAGTGGTGTTAGAAA
CGGTTACCATATTATTGAAGAACAATCAAGACTAGAGAGATCAAAACAGC
CACCTTCACTTCTTCAAGTATTGAGCCTTAGCATTACATGA
back to top
Protein Sequence

aradu.Aradu.K68B1.1 sequence

>aradu.Aradu.K68B1.1
MEKKLIRPCDREYMRMAMLKHEQTFKQQVYELHRLYRIQQALMKNMEGSS
SRISEIEESEIELTLGPSSHYNRKKVVEASPLTSDSGQSFSSSSGSGSGS
CFIHNNTSFKTHQYHSSHREELGGGIIGLVQVPHSSSGVRNGYHIIEEQS
RLERSKQPPSLLQVLSLSIT.
back to top