Description
Gene Model Namearadu.Aradu.L2R5W
Micro Synteny Viewaradu.Aradu.L2R5W
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_C90JX8
Descriptionovate family protein 6; IPR006458 (Ovate protein family, C-terminal)
Protein domainsPF04844 TIGR01568
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.L2R5W.1

Sequences
Gene Model Namearadu.Aradu.L2R5W
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.L2R5W.1 sequence

>aradu.Aradu.L2R5W.1
ATGTCTTCCAACAACAAACAAGCTCTTTTCAAAACTGTATTCACAATAAA
CGGTAGCTGTGGCTGCGGCAAAACAAAGGCCTTAGAGGTACACGAACCAA
CCCCAAAACCCAAAATCTCCATTCACCAGAACAACACAAATACAACAATT
AACAACCCTAGCAGCATGGCTTCTTCATTCACCACTACTTCGCACAACGG
TGCCTTCTCCGGCGCTGAGGACGAAGATTCCTCCACCACAATCTCTGAAT
CCGAAACCACCCATGAGCATATCAGCAATAACCTTATTATCCCCAAACGA
AGCCCACTCATGGATACACTTGCAGTTGAGAAGGACTCTTCGGACCCATA
TCATGATTTCCGGCATTCCATGCTCCAAATGATCTTCGAGAAAGAGATTG
AATCTAAGGATGATCTTCAGGATCTTCTTCAGTGTTTTCTTCAGCTGAAT
GCACCTCATTACCATCATATCATCGTTAAGGCCTTCAATCAGATATGTGA
AGAGGCCTTCCCTGAGAAGGTTTGTACTACTACCCCTTCTATTGACAGAA
GATCTTCCTCTTGTAGGAACACCTTCATCGTTCACAAGACTTGCCGCTGA
back to top
Protein Sequence

aradu.Aradu.L2R5W.1 sequence

>aradu.Aradu.L2R5W.1
MSSNNKQALFKTVFTINGSCGCGKTKALEVHEPTPKPKISIHQNNTNTTI
NNPSSMASSFTTTSHNGAFSGAEDEDSSTTISESETTHEHISNNLIIPKR
SPLMDTLAVEKDSSDPYHDFRHSMLQMIFEKEIESKDDLQDLLQCFLQLN
APHYHHIIVKAFNQICEEAFPEKVCTTTPSIDRRSSSCRNTFIVHKTCR.
back to top