Description
Gene Model Namearadu.Aradu.LB7SQ
Micro Synteny Viewaradu.Aradu.LB7SQ
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_27G8K7
DescriptionATP sulfurylase 1; IPR002650 (Sulphate adenylyltransferase), IPR014729 (Rossmann-like alpha/beta/alpha sandwich fold), IPR015947 (PUA-like domain); GO:0000103 (sulfate assimilation), GO:0004781 (sulfate adenylyltransferase (ATP) activity)
Protein domainsG3DSA:3.10.400.10 G3DSA:3.40.50.620 PF01747 PF14306 PTHR11055 PTHR11055:SF18 SSF52374 SSF88697 TIGR00339
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.LB7SQ.1

Sequences
Gene Model Namearadu.Aradu.LB7SQ
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.LB7SQ.1 sequence

>aradu.Aradu.LB7SQ.1
CAAGATCTTTCTTCATTGTGCTCTTTCTTTTTTTTTTTGGTAAGGGTCCC
CAAATTTTTCAACTTGCTACTAGTTACATGGACTAGTACCTTTTTCTCCT
CCACAAACACAAAAAAGGCACAAAGATACCAACTTGGGTGGCTCTAACAT
GTTTCCCAAATCTAGAGGTTCTTGTTCAACTCCGTCAGACAACTACTTCT
CTTGTTCTAACATAATATATTCTCTCTCTCACACAGTAATCTCCAACACC
AACAACAATGTCTCTCTCCATTAAGTTACATGTAACAACTTCCCATCTAA
ATTACCTCAACCACCATGCCAAAACCAACACCAACACTAACACAAGTAAC
ATTAGAACCAAACCAATTTACACTTCCAACCCATTGATCATAACAACTAG
TAGGTCTAGAAAAATGAGCTTAGGCTCCTATGGTGCACCCTTTATTAAGA
GCTCATTGATTGAGCCAGATGGGGGTGCATTGGTGGACCTTGTGGTGCCA
GAGTCTCAAAGGGGTCCTAAGATTTTGGAAGCTGAGGCACTTCCAAAGGT
AAAGCTCACAAAGATTGATATAGAGTGGGTGCATGTGATTAGTGAAGGTT
GGGCTAGCCCCTTGAGAGGGTTCATGAGGGAAGATGAGTACTTGCAAAGC
CTTCATTTCAATGCTTTGAGGTTGAAAGGAAATGGATCTTTGGTGAACAT
GTCACTACCAATTGTGTTGGCAATTGATGATCAGACCAAGGAGAAAATTG
GGAATTCCTCCAATGTTGGGTTGCTTGGTCCCAGTGGAGATTGCATTGCT
ATTCTTAGAAGCATTGAAATCTATAAGCACAACAAGGAAGAAAGAATAGC
TAGAACATGGGGAACAATTGCTGTAGGGCTGCCATATGTAGAGGAGGCGA
TTACTCCGGCCGGAAACTGGCTTCTCGGAGGAGACTTGGAAGTGCTAAAG
CCTATCAAGTACAATGATGGCCTTGATAACTACAGGCTATCTCCTAAACA
ACTCCGTGAGGAATTCGACGGGCGAGAAGCCGATGCAGTTTTTGCCTTTC
AGTTAAGAAACCCTGTGCATAATGGTCATGCCTTGTTAATGAATGATACT
AGAAAGCGCCTATTGGAAATGGGATACAAAAATCCAATTTTGTTGCTTCA
TCCTCTTGGTGGTTTCACAAAAGCTGATGATGTGCCTTTGAGTGTTAGAA
TGGAGCAACATAGCAAGGTCTTAGAAGATGGAGTTCTTGATCCTGAGACC
ACCATAGTGGCTATATTTCCTTCACCTATGCACTATGCCGGTCCAACCGA
GGTGCAGTGGCATGCCAAGGCTAGGATCAATGCTGGTGCCAACTTCTATA
TTGTCGGTCGCGATCCAGCTGGCATGGGACACCCAACTGAGAAGAGGGAT
CTATATGATCCTGATCATGGTAAAAAGGTGTTAAGCATGGCACCTGGCCT
AGAAAAGCTTAATATTTTGCCATTTAGGGTAGCAGCATATGATACTAGTG
AGAATAAGATGGCATTTTTCGATCCCTCTCGCGCCAAGGATTTTCTCTTC
ATATCCGGAACAAAGATGAGGGCTTATGCAAAAAGTGGAGAGAATCCACC
AGATGGTTTTATGTGTCCTAATGGATGGAAGGTTCTTCTTAAATACTATG
AAAGTTTGCAAACTGAAGAGTCACCACAACAGCCTGCAGTGTTATCTGCA
TAGATTCACATAACTGTTATGTTTTGCATTTTTGTTTTCATATATAAAGG
AAGATTCTAGAAGCACAGTTTTAGGAGTGCCTTCATGATCAAGAAATCAT
ATCATGAATGGGCAATCATATTTGAATTAATATGTGTATCATTTTGATCT
TTGCAAAAGGAATTAGTACTATGCTTTTAGCCTTTTAAGAATTTTGTTTG
TGGTAGCTTCTGTATAAAATGAGTTTGAATTTCAAATTAGTTTTGCATGA
AACATGCTACAAAATAAATATTATTT
back to top
Protein Sequence

aradu.Aradu.LB7SQ.1 sequence

>aradu.Aradu.LB7SQ.1
MSLSIKLHVTTSHLNYLNHHAKTNTNTNTSNIRTKPIYTSNPLIITTSRS
RKMSLGSYGAPFIKSSLIEPDGGALVDLVVPESQRGPKILEAEALPKVKL
TKIDIEWVHVISEGWASPLRGFMREDEYLQSLHFNALRLKGNGSLVNMSL
PIVLAIDDQTKEKIGNSSNVGLLGPSGDCIAILRSIEIYKHNKEERIART
WGTIAVGLPYVEEAITPAGNWLLGGDLEVLKPIKYNDGLDNYRLSPKQLR
EEFDGREADAVFAFQLRNPVHNGHALLMNDTRKRLLEMGYKNPILLLHPL
GGFTKADDVPLSVRMEQHSKVLEDGVLDPETTIVAIFPSPMHYAGPTEVQ
WHAKARINAGANFYIVGRDPAGMGHPTEKRDLYDPDHGKKVLSMAPGLEK
LNILPFRVAAYDTSENKMAFFDPSRAKDFLFISGTKMRAYAKSGENPPDG
FMCPNGWKVLLKYYESLQTEESPQQPAVLSA.
back to top
Expression

Gene expression for aradu.Aradu.LB7SQ has been determined by its associated transcript, Adur20118_comp0_c0_seq2 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.