Description
Gene Model Namearadu.Aradu.M63CN
Micro Synteny Viewaradu.Aradu.M63CN
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_0NT83G
DescriptionCytochrome P450 superfamily protein; IPR001128 (Cytochrome P450); GO:0005506 (iron ion binding), GO:0020037 (heme binding), GO:0055114 (oxidation-reduction process)
Protein domainsG3DSA:1.10.630.10 PF00067 PR00385 PR00463 PTHR24298 SSF48264
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.M63CN.1

Sequences
Gene Model Namearadu.Aradu.M63CN
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.M63CN.1 sequence

>aradu.Aradu.M63CN.1
ATGGATCTGTTCACCACCATCATATTACTATCTTTGTTCATTATCGTACT
CATCATGAAATGGCAGTATTTCAAACACACAGACAAAAACTCACCTCCTT
CACCTCCAAAACTACCCATACTCGGAAACTTGCACCAAATAGGTTTGTTC
CCGCACCGGTCACTCAAAAGCTTGGCTGAGAAACATGGCCCCTTGATGCT
CCTTCACTTCGGGAACGTTCCGGTGCTGGTGGTGTCTTCGGCCGACATGG
CGGAAGAAGTGATGAAGACGCACGACTTGGTGTTCTCCAACCGGCCACCG
CGGAAGATGAGTGAATACTGGAGGCAGATAAGGAGCCTAGCCGTGTTACA
CCTTCTGAGCAACAAAAGGGTTCAATCGTACGGCCTTATTAGGGAGGAAG
AAGCTGCAAGAATGGTTGAAACCATCAAAGAGTTTGCTTCTTCTTCTTTT
TCTATGCCGTTAAACTTGTCTGAGATATTCTTCGGTGTTACAAATGACAT
ATTGTGTAGAAGTGCTCTAGGGAGGAGATACCGTGGAGGAGGAGAAGGGT
GCAAGTTTCAGGAGCTGGTTTTGGAGTTTGGAGACTTGTTGGGTACAACA
TCAATAGGGGACTATATTCCATGGCTTAGTTGGTTGAACAAGGTTGATGG
TTCTTATAAAAGAGCGTCAAGAGTGGCCAAGCGTCTCGATGAGTTTTTGG
ATCAAGTGATTGCGGAGCATGTTAGTTCTGGGAAAAGGAAAGAACAAGAG
GGACTTACTGATAATGTTGATGATTTTGTGGATGTTTTGCTTTCTGTCAA
GAACAGTAACGCTGTTGGATTTGAGTTTGACACAACAACAATGAAGGCAA
TACTCGTGGACATGTTTACGGCAGGTACGGACCCTACGTACACTGTGCTA
GAATGGGCAATGGCGGAACTGTTAAAACGGCCAGCGATTATGCACAAACT
TCAAGATGAAGTGAGAACTGTTGTTGGAAACAGAAGCAACATAACCGAAC
AAGATTTGGTTCACATGAACTACTTGAAAGCTGTGATGAAAGAAACACTT
CGGTTGCACCCTTCACTTCCAGTTCTAGTTCCTAGAGAATCCACCAAAGG
CATCAAGCTGAATGGGTATGACATTGAAGCTGGAACACAGGTGTTGGTGA
ATGCATGGGCCGTTGCAACGGATCCAAAGTGTTGGGACCAGCCACTTGAG
TTCAAGCCAGAGAGGTTCTTAAACAGTTCGGTGGATTTCAAAGGGCGTGA
TTTTCAGTTTATTCCTTTTGGTGCAGGAAGGAGAGGGTGCCCTGGGCTGC
AGTTTGCCACTGCTCTTGATGAAACTGTGCTGGCTAACCTTGTTTACCAT
TTTGATTGGGATTTGCCTGCTGGTTCTAAGGAATTGGACTTGTCTAAATT
TTATGGACTAGTCCTGCATTTGAAATCACCTCTCTTGGCTATACCAACCC
CTTATTATGAATGAATAGTATTGAATTGAATAAGTTATTGTTGGGTATAT
GAAGATGGTAAGATGACAAAATTTTATATTTGTGT
back to top
Protein Sequence

aradu.Aradu.M63CN.1 sequence

>aradu.Aradu.M63CN.1
MDLFTTIILLSLFIIVLIMKWQYFKHTDKNSPPSPPKLPILGNLHQIGLF
PHRSLKSLAEKHGPLMLLHFGNVPVLVVSSADMAEEVMKTHDLVFSNRPP
RKMSEYWRQIRSLAVLHLLSNKRVQSYGLIREEEAARMVETIKEFASSSF
SMPLNLSEIFFGVTNDILCRSALGRRYRGGGEGCKFQELVLEFGDLLGTT
SIGDYIPWLSWLNKVDGSYKRASRVAKRLDEFLDQVIAEHVSSGKRKEQE
GLTDNVDDFVDVLLSVKNSNAVGFEFDTTTMKAILVDMFTAGTDPTYTVL
EWAMAELLKRPAIMHKLQDEVRTVVGNRSNITEQDLVHMNYLKAVMKETL
RLHPSLPVLVPRESTKGIKLNGYDIEAGTQVLVNAWAVATDPKCWDQPLE
FKPERFLNSSVDFKGRDFQFIPFGAGRRGCPGLQFATALDETVLANLVYH
FDWDLPAGSKELDLSKFYGLVLHLKSPLLAIPTPYYE.
back to top
Expression

Gene expression for aradu.Aradu.M63CN has been determined by its associated transcript, Adur13368_comp0_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.