Description
Gene Model Namearadu.Aradu.P9DZZ
Micro Synteny Viewaradu.Aradu.P9DZZ
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_64DJKS
DescriptionCYCLIN D4; 1; IPR015451 (Cyclin D); GO:0005634 (nucleus), GO:0007049 (cell cycle)
Protein domainsG3DSA:1.10.472.10 PF00134 PF02984 PTHR10177 PTHR10177:SF76 SM00385 SSF47954
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.P9DZZ.1

Sequences
Gene Model Namearadu.Aradu.P9DZZ
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.P9DZZ.1 sequence

>aradu.Aradu.P9DZZ.1
ATGGCTGAGAACTCAAACCTTCTACTATGTTCCGAAAACAACATCACTTG
TTTTGATGATGATGATGATGATGGTGATGATTTGGAGTGTAATGTTGCTG
CTGCTGATGGGTCTGGAATCTTACCATGTTGGGACCACACCAACAACCTT
AACTCCGACCAACCATGTCCGAGTTCAGAAAACCGTGGATCGGGTCCATT
GTATTGTTTTGATGTTCTGAGTGAAGAAACAATGAAAGACATGGTGGAAA
GGGAAAAAGAGCATTTACCAAAGGAGGATTATCTTAAGAGGCTACGTAGT
GGGGACTTGGACCTCAGTGGTAGGAGAGAGACCATTGATTGGATTTGGAA
GGCTCATTCCTATTATGGTTTTGGACCCTTGACCTTTTGTCTATCTGTGA
ACTACTTGGATCGCTTCTTATCCTTGTATGAATTGCCGAGAGGTAAAAGT
TGGACTATGCAATTGTTAGCTGTAGCTTGCTTGTCGATTGGGGCGAAAAT
GGAGGAGGTTAAAGTGCCGCAATCCGTCGACTTACAGGTTGGAGAACCAA
AGTTTGTATTTGAAGCTAAAACCATTCAAAGAATGGAACTATTGGTGTTA
AGCACATTGAGATGGAAAATGCAAGCTTTAACTCCTTGTTCCTTCATAGA
TTATTTCCTAAAGAAGATCACTTTCAAGCAACATTTGGCGAATCGGACCA
TTTCGAGATCAATACAGCTCACCCTTAGCATAATTAGAGGGATTGACTTC
TTGGAGTTCAGGCCTTCTGAAATCGCAGCGGCTGTGGCGATTTCTGTTTC
AAAGGAGTTGCAACAAGCGAAAGATATCGATAAGGCCTTAGCTAGCTTCT
TCATTGCAGAGAAGGTGAGGGTGGTAGTGGTGGTGGTGGTTCCCACAAAA
ACACAACAAAAAGGGCCACAAGACAAAATTGCTTTTGCTTTTGTCCTTAT
AGAGAAAGTTCTAAAGTGTGTTGAATTGATAAGAGACTTGGCATTGATGA
ATGTTTCTAATTTTGGTGCAAAACATCATGTGCCATTTGTGCCTCAAAGC
CCAATTGGGGTGCTTGATGGTGGTGGATGCTTGAGCTATAAGAGTGATGA
ATTAACAACACTTGGTTCCTCATGCCCAAATAGTCCAAAAACTAAAAGGT
TCAAATCAGAAGGAGGACCTTGTTGTAATGGGACATCAGATTCATGAAAA
AATGTGGATTATGCTCTCATTTGGTTTGGTTGAATGGGAGTTTAGTGTGT
GTGGAGGCAACTCTTCATTGGTAACACCTAATCAAAGAGTGTGTTATGTT
CATGCTATAAGCATGTTACAAACAAAGAAGAAGAAGAAAAAGAATCATAG
GGTGTTACCATTTGTTTATATAGTGAGATTATTACACAACAGCAACGGAT
GCAAAAAATATAGCAAGGAAATGAGGTTGGTGGAGAAAATTTTGATGAAA
CCAGGGTTGGCCTGTGAATTGTGATCATTGGAGAGAAATCAGAGAATAGC
TATAATTGTTTTTCCATGTCCTAAATTGTCATTGTAGGACGAAGATAATT
ATTATAATATAAAGCAAAA
back to top
Protein Sequence

aradu.Aradu.P9DZZ.1 sequence

>aradu.Aradu.P9DZZ.1
MAENSNLLLCSENNITCFDDDDDDGDDLECNVAAADGSGILPCWDHTNNL
NSDQPCPSSENRGSGPLYCFDVLSEETMKDMVEREKEHLPKEDYLKRLRS
GDLDLSGRRETIDWIWKAHSYYGFGPLTFCLSVNYLDRFLSLYELPRGKS
WTMQLLAVACLSIGAKMEEVKVPQSVDLQVGEPKFVFEAKTIQRMELLVL
STLRWKMQALTPCSFIDYFLKKITFKQHLANRTISRSIQLTLSIIRGIDF
LEFRPSEIAAAVAISVSKELQQAKDIDKALASFFIAEKVRVVVVVVVPTK
TQQKGPQDKIAFAFVLIEKVLKCVELIRDLALMNVSNFGAKHHVPFVPQS
PIGVLDGGGCLSYKSDELTTLGSSCPNSPKTKRFKSEGGPCCNGTSDS.
back to top