Description
Gene Model Namearadu.Aradu.PJ77P
Micro Synteny Viewaradu.Aradu.PJ77P
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_2D380K
Descriptionvacuolar H+-translocating inorganic pyrophosphatase; IPR004131 (Pyrophosphate-energised proton pump); GO:0004427 (inorganic diphosphatase activity), GO:0009678 (hydrogen-translocating pyrophosphatase activity), GO:0015992 (proton transport), GO:0016020 (membrane)
Protein domainsMF_01129 PF03030 PIRSF001265 PTHR31998 PTHR31998:SF0 TIGR01104
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.PJ77P.1

Sequences
Gene Model Namearadu.Aradu.PJ77P
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.PJ77P.1 sequence

>aradu.Aradu.PJ77P.1
CATTGGCCTTGAGCTGGTTGATGATCTTCAATCTGAGGGCATCGATTGTG
CCGTCGTTCATGAGGGACTCAAGCACATCCTCCGGAGTGATGATAGAGGA
AGAAGCCATGAGAGTCAAAATTGCAGAAAACCGTAACCCTGGATGATGTA
TTTCGAGTCTCGCGTTGATCGATGCTTATACTACAATTGCGAATGTCTGG
GGTTCAGTATAGATAAATATATACACCTTCCAGAAAACGTTGTCGTATTA
ATGGGTAAAAGAGGGTGGAGCGCAGTGTCAGTTTGAGAAAAACGGGGACT
CAGAAAAACCCTAAAAATACGATGGAGAGGGGAATAGAGATGAAGATGAG
GGTGAGGCGAAGAGGAAAAGTTATATAACCGTTTTTATTAGATAAATTTT
GTTATGACGAAACTACCCTTCATGAATCATTCTCTCACTCTCCGTCTCCG
TTCACACCATTCTGGCATTCTCTCTCAAGTTTCATCCCAAAACCCTTCTC
AACCATCATCGCTACCAGAATCTCCAAACCCTCCCTCTCCAAAACTGTGG
TAGCATGGCAGACTCAGATGAACCCCAACCGCCAACCGACTCGTCCCAAA
ATGGCCTCACTTCCCTCGATAATTACCCCGTGCCACTGTCCCCTCCACTC
CCCGCAATCTCCAAGCAAATCGAGCTAAGCCGAGCCATGACCGCATCTTC
GAAATCGAGCCTCTTCTCTCTCTCAACGTGCCACGTCATCTACGAAGACC
AATGGCTCATCGCAATCAACAAGCCCCAAGGAATCTACTGCGAAACCATC
CTCTCTTCCGTTCCAACCCTTCTCAAACCACATCAAGGTGTCCACGTCAG
CGTGCCTGAGCTGCACCTTGCTAACCGTCTCGACCGCGACACAAGCGGCG
TGACGATTATTACGAAGTCCCACAAAGTGGCATCGAAGTTCGTGAAGGCA
TTCACCGACCACGAGGTTCGTAAAACCTACATCGCTCTCTGCAGTGGCGT
GGCCCCGAAGTGGAACAGGATTACCGTTAGGTCCGGGCACGGGAGGTCCA
AGTTTGGCGCGTGGCGCGTTTACGCTGCCTCCGATGTCGGGCGGAAGCTA
CCAGGCGGTTCGGTAGTCCGTGGCATGGAGACTTCGTTCGAGGTTTTATC
GGTAAACGGAAGCGGAACGTTCAGAGACGAGTCGGAAATTAACGACGGTG
GTGATGTGGTGGTTGTTGAGGAGAGAGCTGTGAGAGAAGGTAGTGGTGGC
GATGCAGAGAGTGAGATAATAGTGAGGGCGTATCCTACGAGTGGAAGAAC
GCATCAGATTCGGTTGCATTGTCAGTACCTTGGGATTTCGATTGTAGGGG
ACGTGAAGTATGAAGGGGTCTGTGAATGGAAAGAGGTGGCGCGTGAGGGC
CACGCGCTTCATGCCGAGAGCTTATCGTTCAAGCACCCCGTTACTGGCGA
TCGCATTTCACTACACGCGCCGCTTCCATCTTGGGCCAATAAGGCCTTGC
AGTTGCAGCACTGAGGAAATTGTGTGTGTTTTGCAAAAGAGACCTTTAAT
TTAAAGGAATCATTGTCATGTCCTTGTTGCGATGAAGATCAGGGTCGTTA
TCTTTTGAAACCTGCTTCAGTGCTCTCTCCAAACTGTCAAATACTAACGG
AGTAACAGTACATTCAGAGTTTGGTTGCTCCTCGGCCACATGCAGTGGAC
GCCTGAGAAATTTGCTAATTTGGAGATTTTAAGATTGGTCTCCCAGGCTA
TAAAACTCGGTGGTTGATTATGCTATTTTAGCTAAAGAAGTTTACAACAA
AATTTTCAACTGCGATATTTGGAAAATGGGGGAGTTGAGTGAGGGCCTTA
CACAAGTTCTGATACCTGTGGCAGCATTAATTGGAATTGGATTTGCTTTG
CTTCAATGGTTCTTGGTCTCAAAGGTCAGAGTGTCTGCTGTTGCTGATTA
CAATGGCAGGGACAATGGGCACAAAAGCAGCTTACTAGGAGATGCAGAGT
TGGAGACTGGTGTCCGGGTTCCTGAAGTTACTGCTAAGTGTGCCGAAATT
CAGCATGCCATTTCTGTTGGTGCTACTTCGTTTCTCTTTACTGAGTATAG
GTACCTGACTATCTTCATGGGAGTATTTGGTGTAATAATTTTTCTGTTTC
TGGGCTCTGTGAAGGGCTTTAGTACCAAAAGCGAACCTTGCACCTACAAT
GAAGGCAATCTTTGTAAACCAGCGCTTGCCAATGCTGTGTTTAGCACTAT
AGCTTTCTTGCTTGGTGCCCTTACCTCTGTCCTTTCTGGCTTTCTTGGGA
TGAAGATTGCTACCTATGCCAATGCTAGAACAACTCTTGAAGCAAGAAAG
GGAATAGGAAAGGCCTTTGTTATTGCTTTCCGCTCTGGTGCGGTGATGGG
GTTTCTTCTTGCTGCAAATGGCCTGTTGGTGCTATATGTTGCCATCAATT
TATTCAAACTGTATTATGGGGATGACTGGGAGGGACTTTACGAGTCTATT
ACTGGCTACGGGCTTGGAGGTTCATCAATGGCGCTCTTTGGAAGAGTTGG
AGGAGGCATATACACCAAAGCAGCTGATGTTGGTGCTGACCTTGTGGGGA
AAGTTGAACAGAATATCCCTGAAGATGATCCACGCAACCCAGCTGTTATT
GCTGACAATGTGGGAGACAATGTTGGAGATATCGCAGGTATGGGTTCTGA
CTTATTCGGGTCCTATGCAGAATCATCCTGTGCAGCTCTATTTGTTGCAT
CCATATCATCTTTTGGACTGAATCATGACTACACGGCCATGTCATATCCT
CTCATCATAAGCTCTATGGGAATTGTGATTTGCATGATTACAACTTTTTT
TGCAACTGATGTATTCGAAATAAAATACGAGAACCAAATAGAACCATCCT
TGAAACGTCAACTTCTTATCTCTACTGTATTAATGACCGTTGGTATTGCC
ATAGTCAGCTTCTTTGCTTTGCCATCAGAGTTCACTCTTTATAACTTCGG
CGGCAGCAAGGTTGTCAAGAACTGGCACCTTTTCTTCTGTGTTGCCATTG
GCTTGTGGGCTGGACTTGTAATCGGGTACATTACTGAGTATTTCACTAGC
AATGCTTACAGTCCGGTGCAAGACGTAGCAGATTCCTGCAGGACAGGAGC
TGCAACAAATGTTATTTTTGGATTGGCGCTGGGATATAAGTCGGTCATAA
TTCCCATATTTGCTATTGCAGTTGCTATTTATGTAAGCTTCAGCCTTGCA
GCCATGTATGGAATTGCTGTTGCAGCACTTGGAATGCTGAGTACTATTGC
CACTGGTCTTGCCATTGATGCGTATGGCCCCATCAGTGATAATGCTGGAG
GCATTGCAGAAATGGCTGGATTGAGACATGAGATACGAGAAAGAACAGAT
GCTCTGGATGCTGCAGGAAACACCACTGCTGCCATAGGCAAGGGTTTTGC
TATTGGATCAGCTGCACTTGTGTCTCTTGCATTATTTGGTGCTTATGTGA
GCAGGGCAGGCATAAAAACAGTGAACGTTATGACCCCAAAAGTATTTATT
GGTTTGATTGTGGGAGCAATGCTTCCTCATTGGTTTTCAGCAATGACAAT
GAAGAGTGTTGGGAGTGCGGCTCTCAAAATGGTTGAAGAAGTTCGCAGGC
AATTCAATACTATTCCTGGTCTCCTAGAAGGAACAGGAAAACCAGATTAC
GCAAATTGTGTAAAGATTTCTACCGATGCCTCATTGAAGGAGATGATCCC
ACCCGGTGCACTGGTTTTGCTTGCTCCACTTATTGCCGGAACATTGTTCG
GAGTGGAAACACTTGCTGGGGTACTTGCTGGCTCTCTTGTTTCCGGTGTG
CAGGTGGCAATTTCAGCTTCAAACACTGGCGGGGCATGGGATAACGCTAA
GAAGTACATCGAGGCTGGTATTACGGAGCATGCTGTGTCACTGGGGCCAA
AGGGATCAGATGCTCACAAGGCTGCGGTTATAGGTGACACTGTTGGAGAC
CCTCTCAAAGACACTTCGGGTCCCTCACTCAACATCTTGATAAAGTTGAT
GGCCGTGGAATCATTGGTATTTGCTCCATTCTTCGCAGCTCATGGAGGCT
TAATTTTCAAGTTATTCTGATTTCTCTCTTCTTGCAGTCAACTAAACCCG
GTTTGTGCATATTTGTTCAGCATCATGTAGTGCAGTGGAGCTATGAGATT
GATAGTGTTTTGCTTTCGTTAGTACAGTATATAGTATAACATTACGTAAC
TTTCATTAGGCCAATTTTATTCCAGTAAATCAGCAATAAATTTACATGAT
GTAACTTGAGTGTCATGAAATTTAGATGTCATTGTTAATTTATGAAAATA
TTAGTTAATAACTTAATATTTATGGTATATGGATTACGCGTGACATGTGC
GAGTATAATGAA
back to top
Protein Sequence

aradu.Aradu.PJ77P.1 sequence

>aradu.Aradu.PJ77P.1
MGELSEGLTQVLIPVAALIGIGFALLQWFLVSKVRVSAVADYNGRDNGHK
SSLLGDAELETGVRVPEVTAKCAEIQHAISVGATSFLFTEYRYLTIFMGV
FGVIIFLFLGSVKGFSTKSEPCTYNEGNLCKPALANAVFSTIAFLLGALT
SVLSGFLGMKIATYANARTTLEARKGIGKAFVIAFRSGAVMGFLLAANGL
LVLYVAINLFKLYYGDDWEGLYESITGYGLGGSSMALFGRVGGGIYTKAA
DVGADLVGKVEQNIPEDDPRNPAVIADNVGDNVGDIAGMGSDLFGSYAES
SCAALFVASISSFGLNHDYTAMSYPLIISSMGIVICMITTFFATDVFEIK
YENQIEPSLKRQLLISTVLMTVGIAIVSFFALPSEFTLYNFGGSKVVKNW
HLFFCVAIGLWAGLVIGYITEYFTSNAYSPVQDVADSCRTGAATNVIFGL
ALGYKSVIIPIFAIAVAIYVSFSLAAMYGIAVAALGMLSTIATGLAIDAY
GPISDNAGGIAEMAGLRHEIRERTDALDAAGNTTAAIGKGFAIGSAALVS
LALFGAYVSRAGIKTVNVMTPKVFIGLIVGAMLPHWFSAMTMKSVGSAAL
KMVEEVRRQFNTIPGLLEGTGKPDYANCVKISTDASLKEMIPPGALVLLA
PLIAGTLFGVETLAGVLAGSLVSGVQVAISASNTGGAWDNAKKYIEAGIT
EHAVSLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFA
PFFAAHGGLIFKLF.
back to top
Expression

Gene expression for aradu.Aradu.PJ77P has been determined by its associated transcript, Adur44006_comp0_c0_seq2 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.