Description
Gene Model Namearadu.Aradu.QVN0R
Micro Synteny Viewaradu.Aradu.QVN0R
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_0MXDQN
Descriptionalpha-1,4-glucan-protein synthase [UDP-forming]-like protein; IPR004901 (Reversibly glycosylated polypeptide family); GO:0016866 (intramolecular transferase activity), GO:0030244 (cellulose biosynthetic process)
Protein domainsPIRSF016429 PTHR31682 PTHR31682:SF0 SSF53448
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.QVN0R.1

Sequences
Gene Model Namearadu.Aradu.QVN0R
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.QVN0R.1 sequence

>aradu.Aradu.QVN0R.1
CTGTGTTCCTCACACACACACCCCCTCTTCTCTTTTCTCTCCCTCTGTGT
CTCCGATCTGATCTCTCAGAAATTTGAGAATGGCGTCGTCAGTGTTACCG
ACACCACTCCTGAAGGACGAACTTGACATCGTGATCCCAACCATCAGGAA
CCTGGACTTCCTTGAGATGTGGCGCCCCTTCTTCCAGCCCTACCACCTCA
TCATCATCCAAGACGGTGATCCTTCCAAGAAGATCAACGTCCCTGAAGGT
TTCGATTACGAGCTTTACAACCGCAACGACATCAACCGCATCTTAGGCCC
TAAGGCCTCTTGCATCTCCTTCAAGGACTCCGCTTGTCGCTGCTTCGGTT
TCATGGTTTCCAAGAAGAAGTACATCTACACCATCGACGATGATTGCTTC
GTTGCGAAGGATCCATCTGGGAAAGAAATCAATGCTCTGCAGCAGCACAT
TAAGAATCTTCTGAGTCCTTCAACACCATACTTCTTCAACACTCTGTATG
ATCCGTATGCAGAAGGCGCTGATTTCGTTCGCGGATATCCCTTTAGCCTC
CGGGAGGGTGCCCCCACGGCGGTGTCTCATGGGCTTTGGCTCAACATTCC
TGATTACGACGCTCCAACTCAGCTTGTGAAGCCTATGGAAAGGAACACTA
GGTATGTGGATGCAGTTTTGACAATTCCAAAGGGAACCCTGTTTCCCATG
TGTGGTATGAATTTGGCATTCGATCGCGAGCTGATTGGTCCGGCAATGTA
CTTTGGTCTTATGGGTGATGGACAACCCATTGGACGCTACGATGATATGT
GGGCTGGTTGGTGCACAAAGGTTATATGTGACCATTTGGGATTGGGGGTG
AAGACAGGGTTACCCTACATTTGGCACAGCAAAGCCAGCAACCCATTTGT
GAACCTCAAGAAGGAGTACAAAGGGATCTTCTGGCAAGAAGATCTTATCC
CATTCTTCCAAGCTGTCTCTCTTCCAAAGGATTGCACCACTGTTCAGAAG
TGCTACATTGAACTCTCCAAACAATTTAAGGAGAAGTTTGGAAAGGTTGA
TGATTACTTCAACAAGCTTGGAGATGCAATGGTCACATGGATTGAGGCTT
GGGATGAACTTAACCCATCTGCTGCTGCTGCTTTGCCCAATGGTCCTGCA
AAGTAAAATGTATCACTCAGATTTGTTCAGTGTTATAGTTCTGAAGCCTT
TTTGCCTAGGATTTCTGCGGCTTAGTTTAAGTTTTTAGGCAGGGCAGAGG
ATAATGATATGGCGATAGGTATTTTCATTTTACTATTTTCTGAGGGGACC
AGAGTCTAGAACAATAAGCGATTTCAATTTTCATGCCCTTTTAATTTATT
ACATATAGAGATTCTACCGGTTGGGTTTTGTCTTATTATTAGAGTATGTT
AGCTCTTTTAATTGATAGTGAGATTCTGGTCCTTGGAATTTCTTGTCACA
GTTGATTTATTTATGCCAAATG
back to top
Protein Sequence

aradu.Aradu.QVN0R.1 sequence

>aradu.Aradu.QVN0R.1
MASSVLPTPLLKDELDIVIPTIRNLDFLEMWRPFFQPYHLIIIQDGDPSK
KINVPEGFDYELYNRNDINRILGPKASCISFKDSACRCFGFMVSKKKYIY
TIDDDCFVAKDPSGKEINALQQHIKNLLSPSTPYFFNTLYDPYAEGADFV
RGYPFSLREGAPTAVSHGLWLNIPDYDAPTQLVKPMERNTRYVDAVLTIP
KGTLFPMCGMNLAFDRELIGPAMYFGLMGDGQPIGRYDDMWAGWCTKVIC
DHLGLGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEDLIPFFQAVSLPK
DCTTVQKCYIELSKQFKEKFGKVDDYFNKLGDAMVTWIEAWDELNPSAAA
ALPNGPAK.
back to top
Expression

Gene expression for aradu.Aradu.QVN0R has been determined by its associated transcript, Adur35712_comp0_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.