Description
Gene Model Namearadu.Aradu.QYF40
Micro Synteny Viewaradu.Aradu.QYF40
OrganismArachis duranensis (Arachis duranensis)
Assembly versionunknown
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Family not assigned to a gene family
DescriptionDNA-directed RNA polymerase I protein; IPR006592 (RNA polymerase, N-terminal), IPR007066 (RNA polymerase Rpb1, domain 3), IPR007080 (RNA polymerase Rpb1, domain 1); GO:0003677 (DNA binding), GO:0003899 (DNA-directed RNA polymerase activity)
Protein domains
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.QYF40.1
No browser instance available to display a graphic for this gene.
Sequences
Gene Model Namearadu.Aradu.QYF40
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.QYF40.1 sequence

>aradu.Aradu.QYF40.1
ATGGATTATTTTGCGAAAGAATTTTTGGACCTTGGAATTTGTGCTTGTGG
AAATTATCGAGTGATCGGAGAGAAAAAAAAAGACAACCAAAAATTTTGCG
AACAATGTGGGGTAGAATTTGTTGATTCTCGGATACGTAGATATCAAATG
GGCTATATAAAACTCGCATGCCCAGTAACCCATGTGTGGTATTTGAAACG
TCTTCCTAGTTATATCGCGAATCTTTTGGATAAACCTCTTAAAGAATTAG
AAGGTCTAGTTTACTGCGATCCGGATGAAAGGAAACTTTCACGTCCGATT
TTGAAAGGGGGAGATCCCATTGATCCATTGGTTGGATCCTATCCAAATTT
TTCGTTTGCTAGACCCGTCGTTAAAAAGCCTACTTTCTTACGATTACGAG
GTTTATTCGAATATGAAATCCAATCCTGGAAATATAGCATACCACTTTTT
TTTACTATACAGGGTTTCGATACATTTCGAAATAGAGAAATTTCTAGTGG
AGCGGGTGCTATTCGAGAACAACTAGGCGATCTGGATTTGACAATTCTTA
TAAATTCTTCATTAGTAGAGTGGAAAGAATTAGGAGAAGGGGGATCCACG
GGCAATGAAAATGAATGGGAGGCTCGAAAAGTTGGAAGAAGAAAAAATTT
TTTGGTTCGACGTATAGAATTAGCTAAACATTTTATCCGAACAAATATAA
ATCCGGAATGGATGGTTTTATGTCTCTTACCAGTTCTTCCCCCCGAATTG
AGACCCATTATTCAAATCGATGGGGGAAAACTAATGAGCTCAGATATTAA
TGAACTCTATCGAAGAGTTATCTATCGGAACAATACTCTTATCGATCTAT
TAACAACAAGTAGATCTACGCCAAGCGAATTAGTAATGTGCCAGGAGAAA
TTGGTACAAGAAGCCGTGGATACGCTTCTGGATAATGGAATCCGCGGGCA
ACCGATGAGGGATGGTCATAATAAGGTTTACAAATCATTTTCAGATATAA
TTGAAGGTAAAGAGGGAAGATTTCGCGAAACCCTGCTTGGAAAAAGGGTT
GATTATTCGGGGCGTTCTGTTATTGTAGTAGGACCATCACTTTCATTACA
TCGATGTGGATTACCTCGCGAAATAGCAATAGAACTTTTCCAGACATTTG
TAATTCGTGGTCTAATTCGAAAGCATTTTGCTTCGAACATGGGAATTGCT
AAGAGTAAAATTCGGGAAAAAGAACCGATTGTATGGGAAATCCTTCAAGA
AATTATGCAGGGGCATCCCGTCTTGCTAAATAGAGCGCCTACTCTGCATA
GATTAGGCATACAGGCATTCCAACCTATTTTAGTGAAAGGGCGCGCTATT
TGTTTACACCCATTAGTTTGTAAGGGATTCAATGCAGACTTTGATGGAGA
CCAAATGGCTGTTCATGTGCCTTTATCTTTGGAAGCCCAAACGGAAGCTC
GTTTACTTATGTTTTCTCATATGAACCTATTGTCTCCGTCGATGGGAGAT
CCTATTTCCGTACCGACTCAAGATATGCTTATTGGGCTTTATATATTAAC
GAGCGGGAATCGTCGAGGTATAGTCCGTGTAAACGCAGAAATTCGAAAAC
TGAAAGAATTTACAAAAATAACAATAGATATACGAAAAAAAAAAAAAGAA
CCCTTTTTTTGTAATTCCTATGATGCAATTGGAGCTTATCGACAAAAAAA
AATAAATTTCGATAGTCCTTTGTGGTTCCGCTGGCGGCTAGATCAGCGCG
TTATTTCCTCAAGAGAAGCTCCTATCGAAGTTCATTATGAACCGTTGGGT
ATCTATCATGAGATTTATGGTCATTATATAGTAGTAAGAAGTATAAAAAA
ACAAATTCGTTGTATATACATTCGAACTACTGTTGGTCATATTTCTTTTT
ATCGAGAAATCGAAGAAGCTATACAAGGTTTTTGTCGAGCCCATTTATAT
AGTATCTAG
back to top
Protein Sequence

aradu.Aradu.QYF40.1 sequence

>aradu.Aradu.QYF40.1
MDYFAKEFLDLGICACGNYRVIGEKKKDNQKFCEQCGVEFVDSRIRRYQM
GYIKLACPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDPDERKLSRPI
LKGGDPIDPLVGSYPNFSFARPVVKKPTFLRLRGLFEYEIQSWKYSIPLF
FTIQGFDTFRNREISSGAGAIREQLGDLDLTILINSSLVEWKELGEGGST
GNENEWEARKVGRRKNFLVRRIELAKHFIRTNINPEWMVLCLLPVLPPEL
RPIIQIDGGKLMSSDINELYRRVIYRNNTLIDLLTTSRSTPSELVMCQEK
LVQEAVDTLLDNGIRGQPMRDGHNKVYKSFSDIIEGKEGRFRETLLGKRV
DYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRKHFASNMGIA
KSKIREKEPIVWEILQEIMQGHPVLLNRAPTLHRLGIQAFQPILVKGRAI
CLHPLVCKGFNADFDGDQMAVHVPLSLEAQTEARLLMFSHMNLLSPSMGD
PISVPTQDMLIGLYILTSGNRRGIVRVNAEIRKLKEFTKITIDIRKKKKE
PFFCNSYDAIGAYRQKKINFDSPLWFRWRLDQRVISSREAPIEVHYEPLG
IYHEIYGHYIVVRSIKKQIRCIYIRTTVGHISFYREIEEAIQGFCRAHLY
SI.
back to top